KEGG   Meyerozyma guilliermondii: PGUG_05764Help
Entry
PGUG_05764        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00002  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00010  Glycolysis / Gluconeogenesis
pgu00040  Pentose and glucuronate interconversions
pgu00561  Glycerolipid metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGUG_05764
   00040 Pentose and glucuronate interconversions
    PGUG_05764
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PGUG_05764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgu04147]
    PGUG_05764
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     PGUG_05764
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_05764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C AlaDh_PNT_C ELFV_dehydrog NAD_binding_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 5123844
NCBI-ProteinID: XP_001482001
UniProt: A5DR63
AA seq 364 aa AA seqDB search
MSVPDKFQGFGVDDKENWNKPKLVEYERKSIGPNDVVVKNIACGLCYSDIHTLQGNWAPL
NRKGLVVGHEIVGDVISVGDKVTLIKVGQRVGIGAKSSSCMTCHRCQHDNEQYCRKSVGT
YNSKYQDGYVSQGGYSSHSIANEMFVFPLPENLDPYVAAPLMCAGLTVFSPLVRTLGYDA
KGKSVAIIGIGGLGHLAIQFANAIGAEVWAFSRSSSKKQQALDMGATGFVATAEDKDWYK
KYLDKFDMVLNCGSGVEGLNLDHYLNVSKVECKFISVGLPPTSEKFSVSPFTFLSTGGSF
GATALGSKKEVLKMFQIAADKGVKPWIEKVPISEENVTKALDRCEAGDVRYRFVFTELEK
AFKL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtacccgataaatttcaaggttttggagtcgacgataaagaaaactggaataaa
cccaagttggttgagtatgagagaaaatcaattggtcctaatgatgttgtggtgaagaac
attgcttgtggtttgtgctactcggacattcacactttgcaaggaaattgggctcctttg
aaccgtaagggtctcgttgtgggacacgagattgtgggtgatgttatctccgttggtgac
aaagttacgctgatcaaagttggccagagagttggaattggtgccaagtccagttcttgt
atgacttgccaccgttgtcaacacgataacgaacaatattgtcgtaagagtgttggaact
tataacagcaagtatcaagacggatacgtgtcgcaaggtggttactcatcgcattccatt
gccaatgaaatgttcgttttccctcttcctgaaaacttggatccatacgttgctgctcca
ttgatgtgtgctggtttgacagtattttctcctttggtgagaaccttgggctacgacgcc
aagggtaaatccgtagccattatcggtattggtggattgggccatttggctattcagttt
gccaatgctatcggtgccgaagtatgggcattttctagaagctcgtctaaaaagcagcaa
gctttggatatgggtgctacaggctttgttgctacggccgaagacaaggactggtacaag
aaatacctggacaaattcgacatggtgttgaactgtggttctggtgttgaaggtttgaac
ttggaccactacttgaacgtttccaaagtggaatgtaagttcatttccgttggacttcca
cccacttcagaaaagttttctgttagtcccttcactttcctttccaccggaggtagtttc
ggagctactgctttgggaagcaagaaggaagttttgaaaatgtttcaaattgccgccgat
aagggtgttaagccatggatcgaaaaggttcctatcagcgaagaaaacgtgaccaaggct
ttggacagatgtgaggctggtgacgtgagatacagatttgtgttcaccgagcttgaaaag
gcatttaagctttaa

DBGET integrated database retrieval system