KEGG   Meyerozyma guilliermondii: PGUG_05888Help
Entry
PGUG_05888        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     PGUG_05888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 5123969
NCBI-ProteinID: XP_001482125
UniProt: A5DRI7
AA seq 310 aa AA seqDB search
MSSKITTKEQVKKLLDSYDYFLFDCDGVLWLGDHILPFVKETLDLLKSLDKRVIFVTNNS
TKSRKDYRGKFEKLGIPGIQENEIFGSSYALAVYVDKILKLPKDKKVWVLGETGIERELQ
ELGYATVGGSDPKLDETGILPADSEAVNNLDPEVGAVVAGLTLLVNYIKLSATMQYLLKD
NKSIPFIATNIDSTFPMKGKLMIGAGSLIESVAYASGRQPDAVCGKPNQAMMNSIKAANP
DLQAKPGRGLMVGDRLNTDMKFGRDGGLDTLLVLTGIETEESLKQLDPNEAPTYYASKIG
DIYELAGPNN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaaagataactaccaaggagcaggtaaagaagctcttagacagctacgactat
ttcttgttcgactgtgatggcgttctttggttgggagaccatatcttgccttttgtaaaa
gagacactcgacttgttgaagtcactcgataagagagtgatttttgtcaccaacaactct
accaagtcccgtaaagactacagaggaaaatttgagaagcttggaattcccggaattcaa
gagaatgaaatctttgggtcctcgtatgctctggcagtttatgttgacaaaatcctcaag
cttccaaaagacaaaaaagtatgggttctcggagagacaggtattgagagagaattgcaa
gagttagggtacgcaaccgtcggtggaagtgacccgaagctagacgaaaccggtattctt
cccgccgatagtgaagcagtgaataacttggaccctgaagttggagcagttgtcgcaggc
ttgactttgctggtgaactatatcaagctttcggctacaatgcaatatttattgaaggac
aacaaatcaatccccttcattgcaaccaacatagactctacattcccgatgaagggaaag
ctcatgattggtgcgggctctcttatcgaatccgtagcatatgcaagcggcagacagcca
gatgcagtgtgcggtaaaccaaaccaagcaatgatgaattctatcaaggctgctaatcct
gatttacaagcgaaacctggacgcgggttgatggtaggtgacaggttgaatactgatatg
aagtttggtcgcgatggaggattggatacgttattggtgttgacaggcattgagactgaa
gagtcattgaagcaactcgacccgaatgaggccccaacgtactacgcttcgaagattggc
gacatatatgaactcgctggtccaaacaattag

DBGET integrated database retrieval system