KEGG   Polymorphum gilvum: SL003B_0453Help
Entry
SL003B_0453       CDS       T01458                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00010  Glycolysis / Gluconeogenesis
pgv00020  Citrate cycle (TCA cycle)
pgv00620  Pyruvate metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
Module
pgv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SL003B_0453
   00020 Citrate cycle (TCA cycle)
    SL003B_0453
   00620 Pyruvate metabolism
    SL003B_0453
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SL003B_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Esterase PGAP1 DUF2048 Lipase_3 Abhydrolase_5 Abhydrolase_3 DUF2974 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: ADZ68888
UniProt: F2J318
Position
complement(459201..459989)
Genome map
AA seq 262 aa AA seqDB search
MTDLRPAAPAHLPFADQGTGGGSPVVLLHGFGGDRQTWSTIQAGLAPRRRSLAFDLPGHG
DALGWPRVGNAAVAAKAVVQSLDALGLGKVHLVGHSMGGAVAALIALRAPERLSSLTLLA
PGGFGPEINHKLLRRYAAASDEAELEMLLEQFFGWEFRLPRLLARHAAELRARPGACETL
QAIADEIIDGSVQKTLPRDELGSLGLPVKVVWGTQDRVLPTRQSHGLPGVVATHVFERVG
HMPHLEVPAEVIRLIAENAAAD
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccttcgccccgccgcgcccgcccatctgcccttcgccgaccagggcacgggc
ggcggcagccccgtggtgctgctgcacggcttcggcggcgaccgccagacctggtcgacc
atccaggccggtctcgccccgcgccggcgctccctggccttcgacctgcccggccacggc
gacgcgctcggctggccgcgcgtcggcaacgccgccgtcgccgccaaggcggtcgtccag
tcgctcgatgccctcggcctcggcaaggtccacctggtcggccattccatgggcggcgcg
gtcgccgcgctgatcgcgctgcgcgctcccgagcgcctgtcgagcctcaccctgctcgcg
cccggcggtttcgggcccgagatcaaccacaagctcctgcgccgctacgccgccgcctcc
gacgaggccgaactcgaaatgctgctggaacagttcttcggctgggagttccgcctgccg
cggctgctcgcccgccacgccgccgagctgcgcgcgcgccccggcgcctgcgagaccctg
caggcgatcgccgacgagatcatcgacggcagcgtgcagaagaccctgccgcgcgacgag
ctcggcagtctcggcctgccggtcaaggtggtctggggcacccaggacagggtgctgccg
acccgccagtcgcacggcctgcccggcgtcgtcgccacccacgtcttcgagcgcgtcggc
cacatgccgcatctcgaggttccggccgaggtgatccgtctcatcgcggagaacgccgcc
gccgactga

DBGET integrated database retrieval system