KEGG   Polymorphum gilvum: SL003B_1203Help
Entry
SL003B_1203       CDS       T01458                                 

Definition
(GenBank) Putative transcription regulator protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pgv  Polymorphum gilvum
Pathway
pgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SL003B_1203
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pgv02022]
    SL003B_1203
Two-component system [BR:pgv02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   SL003B_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C GerE FleQ
Motif
Other DBs
NCBI-ProteinID: ADZ69632
UniProt: F2J0G4
Position
complement(1290514..1291215)
Genome map
AA seq 233 aa AA seqDB search
MSALKAPDDNASHLLLVDDDSRIRDLLSRVLRDSGYRVTSAANAAEARRCMAGLEFDLLI
LDVMMPGETGLDLARTIRRENTVPILMLTARSDAADRIAGLEVGADDYLAKPFEPRELML
RIAAILRRGGQRRTERTPEIRFGPFVFIAERGELRRGEASIRLTDREKQILSIFAEQPGA
TVPRHKIVGDDSGLGERTVDVQINRLRRKIETDPSNPVFLQTVRGIGYRLACD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgctcaaggcaccggacgacaacgccagccacctgctgctggtcgacgacgac
agccggatcagggacctgctcagtcgggtgctccgcgactccggctatcgcgtcacgtcg
gccgccaatgccgccgaggcccggcgctgcatggccggtctggaattcgacttgctcatc
ctcgacgtcatgatgcccggcgagaccggcctggacctcgcccgcaccatccgtcgagaa
aacacggttccgatcttgatgctgacagcgcgctccgacgccgccgaccgcatcgccggc
ctggaggtcggggcggacgactacctggccaagccgttcgagccgcgcgaactgatgctg
cgcatcgccgccatcctgcggcgaggcggacagcgtcgcacagagcggacgcccgagatc
cgtttcggcccgttcgtgttcatcgccgaacgtggcgaattgcggcgcggcgaggcgtcg
atccgcctgaccgaccgggaaaagcagatcctttccattttcgccgagcagcccggcgcc
acggtaccgcgccacaagatcgtcggcgacgacagcggcctcggagaacggaccgtcgac
gtccagatcaaccggctgcgccgcaagatcgaaaccgatccgagcaacccggtctttctc
cagaccgtgcgcggcatcgggtaccggctggcatgcgactga

DBGET integrated database retrieval system