KEGG   Polymorphum gilvum: SL003B_1744Help
Entry
SL003B_1744       CDS       T01458                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pgv  Polymorphum gilvum
Pathway
pgv03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SL003B_1744 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pgv03011]
    SL003B_1744 (rplV)
Ribosome [BR:pgv03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SL003B_1744 (rplV)
  Bacteria
    SL003B_1744 (rplV)
  Archaea
    SL003B_1744 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADZ70171
UniProt: F2IUU2
Position
1843740..1844120
Genome map
AA seq 126 aa AA seqDB search
MGKPKRERTLADNEAKAVTRMLRVSPRKLNLVAAAIRGKKVGSALADLTFSRKRIAGDVK
KTLMSAIANAENNHDLDVDSLVVAEAHVGKAFVIKRFHARARGRASRIEKPFSNLTIVVR
QVEESA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagccgaagcgtgagcggacgctcgccgacaacgaggccaaggcggtcacccgc
atgctgcgcgtttccccgcgcaagctcaacctcgtggcggctgcgatccgcggcaagaag
gtcggatctgcgcttgccgatctgacgttctcccgcaagcgcatcgccggtgacgtcaag
aagaccttgatgtcggcgatcgccaatgccgagaacaaccatgacctggacgtggacagt
ctggtcgtcgccgaagcccatgtcggcaaggcgttcgtgatcaagcggttccatgcccgg
gcgcgcggtcgcgcgagccggatcgagaagccgttctcgaacctgaccatcgtcgtccgt
caagtcgaggagagtgcctga

DBGET integrated database retrieval system