KEGG   Polymorphum gilvum: SL003B_2199Help
Entry
SL003B_2199       CDS       T01458                                 

Gene name
surE
Definition
(GenBank) 5'-nucleotidase surE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00230  Purine metabolism
pgv00240  Pyrimidine metabolism
pgv00760  Nicotinate and nicotinamide metabolism
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SL003B_2199 (surE)
   00240 Pyrimidine metabolism
    SL003B_2199 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SL003B_2199 (surE)
Enzymes [BR:pgv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     SL003B_2199 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE preATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADZ70624
UniProt: F2IZ09
Position
2320916..2321674
Genome map
AA seq 252 aa AA seqDB search
MRILITNDDGIHSPGLHALERIARTLSDDVWVVAPETDQSGVAHSLTLSDPLRLRRVSER
HFALRGTPTDCVIMGVRKVLPEPPDLILSGINKGQNMADDVTYSGTVAGAMEGAILGIPS
FAISQAYSFARDTEPDYGPAETHGPALFRRLMEFDLPRYTLLNINFPACRAEEVAGVKVT
VQGHHQQAGLIIDERRDGRGYPYFWLAFQARSHDPVGNSDLNAVEAGHISVTPLRLDLTA
HDLVGLLQEKLD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctgatcaccaacgacgacggcatccattcgccgggcctgcacgcgctggag
cgcatcgccagaaccctgtccgacgacgtgtgggtcgttgccccggaaaccgaccagagc
ggcgtcgcccattcgctgacgctgagcgacccgttgcgtctgcggcgggtgtcggagcgc
catttcgccctgcgcggcacgccgaccgactgcgtcatcatgggcgtgcgcaaggtcctg
cccgagccgccggacctgatcctgtcgggcatcaacaagggccagaacatggccgacgac
gtgacctattcgggcaccgtcgccggcgcgatggaaggcgccattctcggcatcccgtcg
ttcgccatctcgcaggcctacagcttcgcccgcgacacggagccggactacggtccggca
gaaacccatggcccggcgctgttccgccggctgatggagttcgacctgccgcgctacacg
ctgctcaacatcaacttcccggcctgccgggccgaggaggtcgccggcgtgaaggtgacg
gtgcagggccatcaccagcaggcaggactgatcatcgacgaacggcgcgacgggcgcggc
tatccatatttctggctggccttccaggcgcgctcgcacgatcctgtcggcaacagcgac
ctcaatgcggtcgaagccggacacatctcggtgacgccgctgcgcctcgacctgacggca
cacgacctggtcggcctgctgcaggaaaagctggactga

DBGET integrated database retrieval system