KEGG   Polymorphum gilvum: SL003B_2282Help
Entry
SL003B_2282       CDS       T01458                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00450  Selenocompound metabolism
pgv00970  Aminoacyl-tRNA biosynthesis
pgv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SL003B_2282
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SL003B_2282
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pgv01007]
    SL003B_2282
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pgv03016]
    SL003B_2282
Enzymes [BR:pgv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SL003B_2282
Amino acid related enzymes [BR:pgv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SL003B_2282
Transfer RNA biogenesis [BR:pgv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SL003B_2282
 Prokaryotic type
   Other AARSs
    SL003B_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADZ70707
UniProt: F2IZY1
Position
2412942..2414498
Genome map
AA seq 518 aa AA seqDB search
MTARPKYYITTAISYPNGAPHIGHAYEAIATDAMARFQRLDGKDVYFLTGTDEHGQKMLQ
TAKKEGISVRELADRNSARFRDMVAALGCTNDDFIRTSEPRHHRSSQEIWRRMAANGDIY
KDSYSGWYSVRDEAYYQEGETELRADGVRYGPQGSPVEWVEEESYFFRLSAYQDRLLAHY
EANPDFIGPAERRNEIVSFVKRGLKDLSVSRTTFDWGIPVPGDEAHVMYVWVDALTNYIT
GVGFPDEDDPLWSYWPADAHIIGKDIIRFHAVYWPAFLMSAGIPLPKRVFAHGFLFNRGE
KMSKSVGNVIDPFNLIEHYGLDQTRYFFLREVPFGQDGNYSHEAIVGRINADLANDLGNL
AQRSLSMIAKNCDGVLPAPGALTPEDEAILGQADVMLDTCRAAFARQEIHQALACVWACV
AEANRYFAAQEPWALRKSDPARMGTVLYVTAEVIRQIAILAQPVTPNAAALLLDNLGVAA
DNRVFARLGAAGRLAAGVAIPKPVPAFPRYVEPESGDA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagaccgaagtactacatcaccaccgccatttcctacccgaacggcgcgccg
cacatcggccacgcctacgaggcgatcgcgaccgacgccatggcgcggttccagcgcctc
gacggcaaggacgtctatttcctgaccggcaccgacgagcacggccagaagatgctgcag
acggcgaagaaggaaggcatttccgtgcgcgagctcgccgaccgcaattcggcccgcttc
cgcgacatggtcgccgccctcggctgtaccaacgacgacttcatccgcaccagcgaaccc
cgccaccaccgctccagccaggagatctggcgccggatggccgcgaacggcgacatctac
aaggacagctactcgggctggtactcggtgcgcgacgaggcctattaccaggaaggcgag
acggagctgcgcgccgacggcgtgcgctacggcccgcagggctcgccggtcgaatgggtc
gaggaggagagctacttcttccgcctgtccgcctatcaggaccggctgctcgcccattac
gaggccaatcccgacttcatcgggccggccgagcggcgcaacgagatcgtcagcttcgtc
aagcgcggcctcaaggacctgtccgtctcgcgcaccaccttcgactggggcatccccgtg
ccgggggacgaggcgcatgtcatgtatgtctgggtcgacgccctgaccaactacatcacc
ggcgtcggctttcccgacgaggacgatccgctgtggtcctactggccggccgacgcccac
atcatcggcaaggacatcatccgcttccacgccgtctactggccggcgttcctgatgtcg
gccggaattccgctgccgaagcgcgtcttcgcccacggcttcctgttcaaccgcggcgag
aagatgtccaagtcggtcggcaacgtcatcgacccgttcaacctgatcgagcactacggc
ctcgaccagacgcgctacttcttcctgcgcgaggtgcccttcggccaggacggcaactac
agccacgaggcgatcgtcgggcgcatcaacgccgatctcgccaacgacctcggcaatctg
gcgcagcgctcgctgtcgatgatcgccaagaactgcgacggcgtgctgccggcacccggc
gccctcacgcccgaggacgaggcgatcctcggccaggccgacgtcatgctagacacctgc
cgcgcggccttcgcccgccaggagatccaccaggcgctcgcctgcgtatgggcctgcgtg
gcggaagccaaccgctatttcgctgcgcaggagccgtgggcgctgcgcaagagcgatccg
gcccgcatgggcaccgtgctctacgtcaccgccgaggtgatccgccagatcgccatcctg
gcccagccggtgacgccgaacgcggccgccctgctgctcgacaatctcggcgtggccgcg
gacaatcgcgtcttcgcccgactcggggcggcaggccgcctggccgcgggcgttgccatc
ccgaagcccgtcccggcgttcccgcgctacgtcgagccggaatcgggcgacgcctga

DBGET integrated database retrieval system