KEGG   Polymorphum gilvum: SL003B_3244Help
Entry
SL003B_3244       CDS       T01458                                 

Definition
(GenBank) Putative 3-ketoacyl-CoA thiolase (Fatty oxidation complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (FadA-like)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00071  Fatty acid degradation
pgv00072  Synthesis and degradation of ketone bodies
pgv00280  Valine, leucine and isoleucine degradation
pgv00310  Lysine degradation
pgv00362  Benzoate degradation
pgv00380  Tryptophan metabolism
pgv00620  Pyruvate metabolism
pgv00630  Glyoxylate and dicarboxylate metabolism
pgv00640  Propanoate metabolism
pgv00650  Butanoate metabolism
pgv00900  Terpenoid backbone biosynthesis
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
pgv01212  Fatty acid metabolism
pgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SL003B_3244
   00630 Glyoxylate and dicarboxylate metabolism
    SL003B_3244
   00640 Propanoate metabolism
    SL003B_3244
   00650 Butanoate metabolism
    SL003B_3244
  Lipid metabolism
   00071 Fatty acid degradation
    SL003B_3244
   00072 Synthesis and degradation of ketone bodies
    SL003B_3244
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SL003B_3244
   00310 Lysine degradation
    SL003B_3244
   00380 Tryptophan metabolism
    SL003B_3244
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SL003B_3244
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SL003B_3244
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SL003B_3244
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SL003B_3244
Exosome [BR:pgv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SL003B_3244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADZ71666
UniProt: F2IY54
Position
3498420..3499628
Genome map
AA seq 402 aa AA seqDB search
MPEAYVYDHVRTPRGRGKKDGALHEVPAVRLAAGVLEAIRDRNELDTAAIDDVILGCVDP
IGEAGGDIARAAVFAAGYATSVPGMQINRFCASGLDAVNTAAAQVMAGQHRMVVAGGVES
MSRIGIGASGGAWPVDPQVALPSYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAARS
WKEGRFAKSVVPVRDINGVTILDRDEHMRPETDMQSLAGLNPSFELMGAMGGFDAVAIQA
HPEVERVRHVHHAGNSSGIVDGAAAVLIGSRKAGKSAGLKPRARIKAFANIGSEPALMLT
GPVDVTDKLLKRAGMTLKDIDLYEINEAFASVVLRYRQAFDLDPDVVNVNGGAIALGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcctatgtctacgatcacgtgcgcaccccgcgcggccggggcaagaaggac
ggcgccctgcacgaggtgccggccgtccggctggccgccggcgtgctggaggcgatccgc
gaccgcaacgaactggacaccgcggcgatcgacgacgtcatcctcggctgcgtcgatccg
atcggcgaagccggcggcgacatcgcccgcgccgccgtgtttgccgccggctacgccacc
tcggtgcccggcatgcagatcaaccgcttctgcgcctcgggcctggacgcggtcaacacc
gccgcggcccaggtcatggccggccagcatcggatggtggtcgccggcggcgtggaaagc
atgagccgcatcggcatcggcgcctccggcggcgcctggccggtcgacccccaggtcgcc
ctgccgtcctacttcatgccccagggcgtgtccgccgatctcatcgccaccaaatacggc
ttctcccgcgacgacgtcgacgcctatgcggtcgaaagccagaagcgcgccgcacggtcc
tggaaagagggtcgcttcgcgaagtccgtggtgccggtcagggacatcaacggcgtcacc
atcctcgaccgcgacgagcacatgcgtcccgagaccgacatgcagtcgctcgccggcctc
aatccgtcgttcgagctgatgggcgcgatgggcggcttcgacgccgtcgctatccaggct
cacccggaagtcgagcgcgtccgccacgtccatcatgccggcaattcctcggggatcgtc
gacggtgccgccgccgtgctgatcggctcgcgcaaggccggcaagtcggccggcctcaag
ccgcgcgcgcgcatcaaggccttcgccaacatcggctcggagcccgcgctgatgctgacc
ggtccggtcgacgtcaccgacaagctgctgaagcgcgccggcatgacgctgaaggacatc
gacctctacgagatcaacgaggccttcgcctcggtggtgctgcgctaccgccaggccttc
gacctcgacccggacgtggtcaacgtcaacggcggcgctatcgcactcggccacccgctc
ggcgccaccggggcgatgatcctcggaaccgtgctcgacgaactggagcgccgcgacctc
aacaccgccctggtcaccctgtgcatcggcgccggcatgggcacggcgacgatcatcgaa
cgcgtgtga

DBGET integrated database retrieval system