KEGG   Polymorphum gilvum: SL003B_3245Help
Entry
SL003B_3245       CDS       T01458                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain family
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00071  Fatty acid degradation
pgv00280  Valine, leucine and isoleucine degradation
pgv00281  Geraniol degradation
pgv00310  Lysine degradation
pgv00362  Benzoate degradation
pgv00380  Tryptophan metabolism
pgv00410  beta-Alanine metabolism
pgv00640  Propanoate metabolism
pgv00650  Butanoate metabolism
pgv00903  Limonene and pinene degradation
pgv00930  Caprolactam degradation
pgv01040  Biosynthesis of unsaturated fatty acids
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
pgv01212  Fatty acid metabolism
Module
pgv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pgv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SL003B_3245 (fadB)
   00650 Butanoate metabolism
    SL003B_3245 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SL003B_3245 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SL003B_3245 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SL003B_3245 (fadB)
   00310 Lysine degradation
    SL003B_3245 (fadB)
   00380 Tryptophan metabolism
    SL003B_3245 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SL003B_3245 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SL003B_3245 (fadB)
   00281 Geraniol degradation
    SL003B_3245 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SL003B_3245 (fadB)
   00930 Caprolactam degradation
    SL003B_3245 (fadB)
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SL003B_3245 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SL003B_3245 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SL003B_3245 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 UDPG_MGDP_dh_N DAO F420_oxidored Sacchrp_dh_NADP FAD_binding_3 ApbA NAD_Gly3P_dh_N Pyr_redox_2 2-Hacid_dh_C NAD_binding_8 DFP AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ADZ71667
UniProt: F2IY55
Position
3499651..3501867
Genome map
AA seq 738 aa AA seqDB search
MTYKNFTLETDADGIALITWDMPGKSMNVIDMSVMDELDALVDAVVADAAIKGAVITSGK
PAFTGGADLTMLGGLLKGYHKDRTKDPEGAARALLDGSRRLSLIYRKLETCGKPFVAAIN
GTCMGGGTELALACHARVGVEDDSFKMGLPEVKVGLFPGAGGTQRVMRMTDGQAGMQFLL
QGQTLRAAKAKAMKLIDETAPAKKLVDTAKKLIKTGVDPVKPWDKKGFKLPNGPIYSPAG
FQFWPAANAIYRRETCDNYPGARYLLQSVYEGLQLPMDLALQVESRYFAHVLQTPEAAAM
IRSLFVSMQELNKLARRPADQRPNKIRKIGILGAGFMGAGIAYVTAQAGINVVLIDRDQE
AADKGKAHSDQLMAKAIQRGRATEAEKEKLLARIDATADYDRLADCDLVIEAVFEDREVK
RVVTEKAEAVMKPRAIYASNTSTLPITSLAEASKRPKNFIGIHFFSPVDKMMLVEVIVGR
KTSDRALAMALDYIKAIRKTPIVVNDSRGFYTSRVVMTYIREGLMMLADGVPAAMIENAG
KMAGMPVGPLSLGDEVALDLAWKIVSATRKDLGVAYVEGPLDNILEEMVVKRERFGRKNG
KGFYDYAGRDKALWPGIVEVVGKPKPADAFNVEEIKQRLLVMQALETARIFEENCLTDVR
EADVGSILGFGFAPYTGGTLSYIDRMGTAAFVDLCRKFTRKWGPRFKPNRLLREMAKANE
SFYGRFPPAGEVKARDAA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaagaatttcaccctggaaaccgatgccgacggcatcgccctgatcacctgg
gacatgccgggcaagtcgatgaacgtcatcgacatgagcgtcatggacgagctcgacgcg
ctggtcgacgccgtcgtcgccgatgcggcgatcaagggcgccgtgatcacctccggcaag
ccggccttcaccggcggcgccgacctgaccatgctggggggcctgctcaagggctaccac
aaggacaggacgaaggatccggagggcgcggcgcgggccctgctcgacggctcgcgccgg
ctgtcgctgatctaccgcaagcttgagacctgcggaaagccgttcgtcgccgcgatcaac
ggcacctgtatgggcggcggcaccgagttggcgctggcctgccacgcgcgcgtcggcgtc
gaggacgacagcttcaagatgggcctgccggaagtgaaggtcggcctgttcccgggtgcc
ggcggcacacagcgcgtcatgcgcatgaccgacggccaggccggcatgcagttcctgctg
cagggccagaccctgcgcgctgccaaggccaaggcgatgaagctcatcgacgagaccgcg
ccggcgaagaagctggtcgacacggccaagaagctcatcaagaccggcgtcgatccggtc
aagccttgggacaagaagggcttcaagctgccgaacgggccgatctattcacccgccggc
ttccaattctggccggcggccaacgccatctaccggcgcgagacctgtgacaactatccg
ggcgcgcgctacctgctgcagtcggtctacgaggggctgcagctgccgatggacctggcg
ctgcaggtcgagagccgctacttcgcccacgtgctgcagacgccggaagcggccgcgatg
atccgctctctgttcgtctccatgcaggagttgaacaagctcgcgcgccggccggcggac
cagcggcccaacaagatccggaagatcggcatcctcggtgccggcttcatgggtgccggc
atcgcctatgtcaccgcccaggccggcatcaacgtggtgctgatcgaccgcgaccaggag
gctgccgacaagggcaaggcccattccgaccagttgatggccaaggcaatccagcgcggc
cgggcgaccgaggccgagaaggagaagctgctggccaggatcgacgccaccgccgactac
gaccggctcgccgactgcgacctggtcatcgaggcggtgttcgaggaccgcgaggtcaag
cgcgtggtcaccgaaaaggccgaggcggtcatgaagccgcgcgccatctacgcgtccaac
acctcgacgctgccgatcacctcgctggcggaagcctcgaagcggccgaagaacttcatc
ggcatccatttcttctcgccggtcgacaagatgatgctggtcgaggtgatcgtgggcagg
aagacctccgaccgcgcgctggccatggcgctcgactatatcaaggcgatccgcaagacg
ccgatcgtcgtcaacgacagccggggcttctacacctcgcgcgtggtcatgacctacatc
cgcgaggggctgatgatgctcgccgacggcgtgccggcggcgatgatcgagaacgccggc
aagatggccggcatgccggtcggcccgctgtcgctcggcgacgaggtggcgttggacctt
gcctggaagatcgtctcggcaacccgcaaggatctcggcgttgcctacgtcgaaggcccg
ctcgacaacatcctggaagagatggtggtcaagcgcgagcgcttcggccgcaagaacggc
aaaggcttctacgactacgccgggcgcgacaaggcgctctggccgggcatcgtcgaggtg
gtcggcaaacccaagccggcggatgccttcaacgtcgaggagatcaagcagcgactgctc
gtgatgcaggcgctggaaaccgcccgcatcttcgaggagaactgcctgaccgacgtgcgc
gaggcggatgtcggctcgatcctcggcttcggcttcgccccctacaccggcggcacgctc
agctacatcgatcgcatgggcaccgccgctttcgtcgacctgtgccggaaattcaccagg
aaatggggaccgcgcttcaagccgaaccgactgctgcgcgagatggccaaggcgaacgaa
agcttctacggccgcttcccgccggccggagaggtcaaggcgcgcgacgcggcctga

DBGET integrated database retrieval system