KEGG   Polymorphum gilvum: SL003B_3535Help
Entry
SL003B_3535       CDS       T01458                                 

Definition
(GenBank) Thiolase, N-terminal domain subfamily, putative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00071  Fatty acid degradation
pgv00072  Synthesis and degradation of ketone bodies
pgv00280  Valine, leucine and isoleucine degradation
pgv00310  Lysine degradation
pgv00362  Benzoate degradation
pgv00380  Tryptophan metabolism
pgv00620  Pyruvate metabolism
pgv00630  Glyoxylate and dicarboxylate metabolism
pgv00640  Propanoate metabolism
pgv00650  Butanoate metabolism
pgv00900  Terpenoid backbone biosynthesis
pgv01100  Metabolic pathways
pgv01110  Biosynthesis of secondary metabolites
pgv01120  Microbial metabolism in diverse environments
pgv01130  Biosynthesis of antibiotics
pgv01200  Carbon metabolism
pgv01212  Fatty acid metabolism
pgv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SL003B_3535
   00630 Glyoxylate and dicarboxylate metabolism
    SL003B_3535
   00640 Propanoate metabolism
    SL003B_3535
   00650 Butanoate metabolism
    SL003B_3535
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SL003B_3535
   00072 Synthesis and degradation of ketone bodies
    SL003B_3535
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SL003B_3535
   00310 Lysine degradation
    SL003B_3535
   00380 Tryptophan metabolism
    SL003B_3535
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SL003B_3535
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SL003B_3535
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SL003B_3535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgv04147]
    SL003B_3535
Enzymes [BR:pgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SL003B_3535
Exosome [BR:pgv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SL003B_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADZ71957
UniProt: F2J111
Position
complement(3826687..3827853)
Genome map
AA seq 388 aa AA seqDB search
MTAAMVGWAHLPFGKHSEETVESLIVKAAVDAIRDAGLEPSDIDEILLGHFNAGFSPQDF
TASLVLQADPALRFTPATRVENACATGSAAVHQGVRAIATGAARFVLVVGVEQMTTTPGP
EVGRNLLRASYLKEEGDIPAGFAGVFGKIADAYFQRHGDQSDALAKIAAKNHRNGVNNPY
AQMRKDLGYEFCRAESDKNPFVAGPLKRTDCSLVSDGAAALVLTDPATALGMRKAVAFRA
LAHVQDFLPMSKRDILKFEGCQQAWGKALGTARLSLDDLSFVETHDCFTIAELIEYEAMG
LTREGEGARAILEGWTEMDGRLPVNPSGGLKAKGHPIGATGVSMHVLTAMQLTGEAGGIQ
VKDAEIGGIFNMGGAAVANYVSILQAMK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagcgatggtgggctgggcgcatctgcccttcggcaagcattcggaagagacc
gtcgagagcctgatcgtcaaggcggccgtcgacgccatccgcgacgccggcctcgagccg
tcggacatcgacgagatcctgctcggccatttcaatgccggcttctcgccccaggacttc
accgcctcgctggtgctgcaggccgatccggcgctgcgcttcacgccggcgacgcgcgtc
gagaacgcctgcgccaccggctcggccgccgtgcaccagggcgtgcgggcgattgccacg
ggcgcggcccgcttcgtgctcgtcgtcggcgtcgagcagatgaccacgacgccggggccg
gaggtcggccgcaacctgctgcgcgcctcctatctcaaggaggagggtgatatcccggcc
ggcttcgccggcgtcttcggcaagatcgccgacgcctatttccagcgccacggcgaccag
tccgacgcgctggcgaagatcgccgccaagaaccacaggaacggcgtcaacaacccctat
gcccagatgcgcaaggatctcggttacgagttctgccgtgccgagagcgacaagaatccc
ttcgtcgccggcccgctcaagcgcaccgactgctcgctggtctccgacggcgccgccgcg
ctggtgctgaccgatccggccacggcgctcggcatgaggaaggccgtcgccttccgcgcg
ctcgcccatgtgcaggatttcctgcccatgtccaagcgcgacatcctcaagttcgagggc
tgccagcaggcctggggcaaggcgctcggcacggcacgtctgtcgctcgacgacctgtcc
ttcgtcgagacccacgactgcttcaccatcgccgagttgatcgaatacgaggcgatgggc
ctgaccagggaaggcgagggcgcccgcgcgatcctcgagggctggaccgagatggacggc
aggctaccggtcaatccgtccggcggcctcaaggccaaggggcatccgatcggcgccacc
ggcgtctccatgcacgtcctgaccgccatgcagctgaccggcgaggccggcggcatccag
gtgaaggacgccgagatcggcggcatcttcaacatgggtggcgccgccgtcgccaactac
gtctcgatcctgcaggcgatgaagtag

DBGET integrated database retrieval system