KEGG   Polymorphum gilvum: SL003B_4097
Entry
SL003B_4097       CDS       T01458                                 

Definition
(GenBank) Chlorobenzene dioxygenase, ferredoxin
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
pgv  Polymorphum gilvum
Pathway
pgv00621  Dioxin degradation
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    SL003B_4097
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ADZ72514
UniProt: F2J6N1
Position
4403426..4403584
AA seq 52 aa
MSDGFLEDGIVECSLHFAKFCVRTGQVKAPPACEALRVFPAKIENDDIYIDC
NT seq 159 nt   +upstreamnt  +downstreamnt
ttgtcagacggtttccttgaagacgggatcgtcgagtgcagccttcactttgcgaagttc
tgcgtcaggacggggcaagtgaaggcgcctccggcctgcgaggctcttcgggtcttcccg
gcgaagatcgagaacgacgacatctacatagattgctga

DBGET integrated database retrieval system