KEGG   Polymorphum gilvum: SL003B_4098
Entry
SL003B_4098       CDS       T01458                                 

Definition
(GenBank) Short-chain dehydrogenase/reductase SDR
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
pgv  Polymorphum gilvum
Pathway
pgv00621  Dioxin degradation
pgv01100  Metabolic pathways
pgv01120  Microbial metabolism in diverse environments
pgv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    SL003B_4098
Enzymes [BR:pgv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     SL003B_4098
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_2 Shikimate_DH 3Beta_HSD Epimerase Polysacc_synt_2 3HCDH_N DUF1664 Lig_C
Other DBs
NCBI-ProteinID: ADZ72515
UniProt: F2J6N2
Position
4403617..4404450
AA seq 277 aa
MKLQDQVALVTGGGSGLGRAIVERYVGEGARVAIFDRSQERIDEVVKELGDRVIGIVGDV
REMDDNRRAVAECVRAFGKLDTLVGNAGVWDWSKSLVSTEDDALVAAFDEMFAINVKGYV
LAAKAALPELYKSRGQMIFTASNASFYPGGGGVIYTATKHAVVGMIKQMAHEFAPHVRVN
GVAPGGIVGSNLAGIGALGQAGHKFSELPLNDLMKQMLPLERAFHAREYAGAYVFFADRR
DNQPATGSVLNFDGGIGMRGFTSPNMGGELVEAFGSV
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaaacttcaggatcaggtcgcgctcgtcacgggcggcgggtcgggactgggccgcgcc
atcgtcgagcgctatgtcggagagggcgcccgcgtcgcaatcttcgaccgttcgcaggaa
cgaatcgacgaagtcgtgaaggaactcggcgacagggtcatcggcatcgtcggtgacgtg
cgcgaaatggacgacaacaggcgcgccgtcgcggaatgtgtcagggcattcggcaagctc
gataccctggtcggcaatgccggtgtgtgggactggtcgaaatcgctggtgtccacggag
gacgacgcgctcgtcgccgctttcgacgagatgttcgccatcaacgtcaagggttacgtc
cttgcagccaaggcggcgctgcccgaactttacaagtcccgggggcagatgatcttcacg
gcatcgaatgcgtccttctacccgggcggcggtggcgtcatctatactgcgacgaaacac
gcggtggtcggcatgatcaagcagatggcgcacgaattcgcgccgcatgtccgtgtgaac
ggcgtcgcccccggcggaatcgtcggcagcaaccttgccgggatcggtgcgcttggccag
gccggacacaagttctcggaactgccgctgaacgacctgatgaagcagatgcttccgctc
gagcgcgcgtttcacgcgcgggaatatgccggtgcctatgtgttctttgccgatcgccgg
gacaaccagccggcaaccggcagtgtgctgaacttcgacggcggcatcggcatgcgcggc
ttcacgtctccgaacatgggcggcgaactggtggaagcctttggcagcgtctga

DBGET integrated database retrieval system