KEGG   Polymorphum gilvum: SL003B_p0038Help
Entry
SL003B_p0038      CDS       T01458                                 

Definition
(GenBank) Conjugal transfer protein
  KO
K07344  type IV secretion system protein TrbL
Organism
pgv  Polymorphum gilvum
Pathway
pgv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SL003B_p0038
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pgv02044]
    SL003B_p0038
Secretion system [BR:pgv02044]
 Type IV secretion system
  Trb secretion system protein
   SL003B_p0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: ADZ72799
UniProt: F2J744
Position
pSL003B:complement(50151..51347)
Genome map
AA seq 398 aa AA seqDB search
MVIVRPSRKLELSFISIGLILLVATPALAQQGSVLTTLENSVVTAAKGWETTVMNAARSL
FWILAGIEVGIAAVWLAINAASLDSWFAELVRRIMFIGLFAFILDQGPSFAKAVVDSLYQ
IGAGGGSASPANIFDAGIRVATKMSEQAKFGLWEDNALAIAAVFAMVVVVVSFSLVAAIF
VAVMVEMYVGLLAGMIMLGLGGSSFTKDFAVKYLVYAFSVGMKLMALVMIAKIGSDILLG
LAEAPTATSEQFITTLAIAGISVVVFVIAMYVPPILQGVVQGASIAGGMEAIRHGGQAAT
FAAGGAFLGASAATKGAQTASSARAGGSSLAGAALRGMASGIGSAGWAAGSAAKEKAIAS
PGAYAGSLLGLANAKLDQTRQSGRPTPPPPPPPINENK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcgtccgtccctcccggaagctggagctttcgttcatttcgatcggcctcatc
ctgttggtcgcgacaccggcgcttgcccaacagggttcggttctaaccacactggaaaac
tccgtcgtcacagccgcgaaaggctgggagacgacggtgatgaacgcggcgcggtcgctg
ttctggatccttgccggcatcgaggtcgggatcgccgcggtgtggctggcgatcaacgcc
gcctcgctcgacagctggttcgccgaactcgtccggcggatcatgttcatcggtctcttc
gccttcatcctcgaccagggcccgtccttcgccaaggccgtggtcgacagcctctatcag
atcggtgccggcggcggctcggcttcacccgcaaatatcttcgacgccggcattcgggtc
gcgaccaaaatgtccgagcaggcgaagttcgggctttgggaagacaatgcgctggcgatc
gccgccgtcttcgccatggtcgtggtcgtcgtctccttctcgttggttgccgcgattttc
gtcgccgtcatggtcgagatgtatgtcggtctgctcgccggcatgatcatgctcggtctt
ggcggctcgtccttcaccaaggatttcgcggtcaaatatctggtctacgccttctccgtc
ggcatgaagctgatggcgctggtgatgatcgccaagattggctccgacatcctgctcggc
ttggcggaagcgccgacagcgacctccgagcagttcatcaccacacttgccatcgccggc
atctcggtggtggtcttcgtgatcgccatgtatgtcccgccgattctgcagggtgtggtc
cagggcgcgtcgattgccggaggtatggaagcgatccgtcatggcggccaggccgcgaca
ttcgcggccggcggcgctttccttggcgcgagtgccgcaacgaaaggagcgcagacggct
agctcggcgagggcagggggctcttcgttggctggagcggcgctgcgcggcatggcgtcc
ggtattggaagtgctggatgggctgccggatccgcagccaaggagaaggcgatcgcgtct
cccggcgcctatgccggatcgctgctcgggcttgccaacgccaagctcgaccagacgcgt
cagtcgggccgaccaacaccgccacctccacccccacccatcaacgagaacaagtag

DBGET integrated database retrieval system