KEGG   Polymorphum gilvum: SL003B_p0042
Entry
SL003B_p0042      CDS       T01458                                 
Name
(GenBank) Conjugal transfer protein
  KO
K20529  type IV secretion system protein TrbD
Organism
pgv  Polymorphum gilvum
Pathway
pgv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pgv00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SL003B_p0042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pgv02044]
    SL003B_p0042
Secretion system [BR:pgv02044]
 Type IV secretion system
  Trb secretion system protein
   SL003B_p0042
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: ADZ72803
UniProt: F2J748
Position
pSL003B:complement(54827..55126)
AA seq 99 aa
MAEAGSRLSRSRVHRALSRPNLLMGADRELVLLTALAAVILIFVVLTWYAALFGIAIWLI
AVAALRMMAKADPLMRRVYVRHISYKAFYRATSSPWRKF
NT seq 300 nt   +upstreamnt  +downstreamnt
atggctgaggccggctccaggctgtcccgttcgcgcgtgcacagggcgctgtcgcgtccg
aacctgctgatgggcgccgaccgcgagctcgtgctgttgaccgcgcttgccgctgttatc
ctgatcttcgtcgtgctgacctggtacgcggcgctcttcggcatcgcaatctggctgatc
gctgtcgcggcgctgcgcatgatggcgaaagctgatcctttgatgcggcgggtctatgtc
cgccatatctcttataaggcgttctatcgcgcgacgtcgtcgccttggcgcaagttctga

DBGET integrated database retrieval system