KEGG   Mixta gaviniae: C2E15_02100Help
Entry
C2E15_02100       CDS       T05418                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pgz  Mixta gaviniae
Pathway
pgz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C2E15_02100 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pgz03011]
    C2E15_02100 (rplV)
Ribosome [BR:pgz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C2E15_02100 (rplV)
  Bacteria
    C2E15_02100 (rplV)
  Archaea
    C2E15_02100 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUX92015
UniProt: A0A1X1E417
Position
478620..478952
Genome map
AA seq 110 aa AA seqDB search
METIAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctcaacatcgccacgctcgttcttctgctcaaaaggttcgcctggtg
gctgacctgattcgcggtaagaaagtgtcgcaggctctggacatcctgacctacaccaac
aaaaaagctgctgtactggtcaagaaggtgctggaatctgccattgctaacgccgaacac
aacgatggcgctgatatcgacgatctgaaagtcgcgaaaattttcgtcgacgaaggccca
agcatgaagcgcattatgccgcgtgcgaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system