KEGG   Mixta gaviniae: C2E15_03940Help
Entry
C2E15_03940       CDS       T05418                                 

Definition
(GenBank) multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
pgz  Mixta gaviniae
Pathway
pgz00760  Nicotinate and nicotinamide metabolism
pgz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    C2E15_03940
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pgz03000]
    C2E15_03940
Enzymes [BR:pgz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     C2E15_03940
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     C2E15_03940
Transcription factors [BR:pgz03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    C2E15_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 CTP_transf_like Citrate_ly_lig HTH_26 HTH_37
Motif
Other DBs
NCBI-ProteinID: AUX92313
UniProt: A0A2L0ICL5
Position
850790..852022
Genome map
AA seq 410 aa AA seqDB search
MSSFEYLKTAIRQQGHTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLAFP
RREKRVGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGHDEPRDRQLFENSAMSQQPTV
SDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSRGITAFMAEKGIEPGCVYTSEE
LDAPQYRQHLGIETIVIDPERSFMNISGAQIRQNPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSVLVNKLANIFNTSSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNVPWVADGLRSLG
SSVDRREFQDLLIKMLNENQIKYEHVTEESYDERFLRCVDLVRNMLENGK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatttgaatatctgaaaaccgcgatccgtcagcaggggcacacgctacagcag
gtggcggacgccagcggcatgaccaaaggctacctgagccagctgctcaacgccaaaatc
aaaagccccagcgcgcagaagctggaagcgctgcatcgctttctggggctcgcgttcccg
cggcgcgagaagcgggtcggcgtggtcttcggcaagttctatcctctgcataccgggcat
atttatctgattcagcgcgcctgcagccaggtcgacgagctgcacattattatgggccac
gacgagccgcgcgatcggcagctgtttgaaaacagcgccatgtcacagcagccgaccgtc
agcgatcgcctgcgctggctgctgcagacctttaagtatcagaagaacattcgcatccat
gcatttaatgaagagggcatggagccttatccgcacggctgggatgtctggagccgcggc
atcaccgcctttatggcggagaagggcattgagccgggttgcgtctataccagcgaagag
ctggacgcaccgcagtatcgtcagcatctcggcattgagacgatagtcatcgatcctgag
cgctcttttatgaacatcagcggcgcacagattcgtcagaatccgtttcgctactgggaa
tatattcctaccgaagtgaagccgttttttgtgcgcaccgtggcgatactcggcggcgaa
tcgagcggtaagtcggtgctggtgaacaagctggctaacattttcaatacctccagcgcc
tgggagtatggccgtgactatgtcttttcccacctcggcggcgatgagatggcgctgcaa
tattccgactatgacaaaatcgcgctgggccaggcgcagtacatcgattttgcggtgaag
tacgccaataaggtcgcctttatcgataccgacttcgtcaccactcaggcgttctgtaaa
aaatatgaggggcgcgaacatccctttgtgcaggcgctgatcgatgaataccgtttcgat
ctggtgatcctgctggagaacaatgttccctgggtagcggacggattgcgcagcctcggc
agctctgtcgaccggcgcgaatttcaggatctgttaataaaaatgctcaatgaaaatcag
ataaaatatgagcatgtaacagaagagagttacgacgaacgcttcctgcgctgtgttgac
ctggtgagaaatatgttggaaaacggaaaatag

DBGET integrated database retrieval system