KEGG   Mixta gaviniae: C2E15_07050Help
Entry
C2E15_07050       CDS       T05418                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pgz  Mixta gaviniae
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C2E15_07050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AUX92862
UniProt: A0A2L0IEQ8
Position
complement(1514589..1516193)
Genome map
AA seq 534 aa AA seqDB search
MSDHGAFARYTTRFPSLYPQPSGRRQRVSLLLVGLLSMAGICWMMTQLSADIRDAFGGAP
PFVSALLLCGALLLALGFVFINGMHDTANAVTTVIYTGTLSPARAVLISAIANMLGVLLA
SGVVAWGVMSLLPAEGMIALDSRHGYALIYALLLAAIVWNLASWYFAIPSSSSHALLGAM
LGVGVASSLLNGQGALAGIDWRQAGWAGWALLLSPLLGFLAAALLLRLMKVLLPLSLTAS
GAPAERPPLWLRGMLILTSSGVSFAHGANDGQKGMGLMMVILLIALPGAFALNRAMPERE
LADLTLLTTQAQAQLPQRAGLSLTSAQAILDNSRQQQGARDGVLPALGAMTASLHQQLSG
IKRLSELPPAETAALRLRMTLTADALQRLLAQENPLSGSQRALLASLTAQLKHASSVIPW
WVKIVVALALGLGTLTGWQRIAITIGERTGKAPLTPIQGASSELVAMTTLGVAEQFGLPV
STTQVLTCGVAGSMVASRSPLQPRTLKRMGLVWLLTLPVCALLSALLYALFIAL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcacggcgcttttgcgcgctatacaacccgctttccctcgctctatccgcag
ccttccggcagacggcagcgcgtctctctgctgctggtcgggctgctgtcgatggccggc
atctgctggatgatgacgcagctctctgcagacatacgcgacgccttcggtggcgccccg
ccgtttgtttccgccctgctgctgtgcggcgcgctgctgctggcgctgggctttgtattt
attaacggcatgcacgataccgctaacgccgttaccacggttatctataccggcacgctt
tctcccgcccgcgcggtgctgatttccgccatcgccaatatgctcggcgtgctgctggcc
agcggcgtggtcgcctggggcgtgatgtcactactgccggcggaggggatgatcgcactg
gatagccgtcacggctacgcgctgatttacgcgctgctgctggcggcgattgtctggaac
ctcgccagctggtatttcgcgatcccctcgtcctcttcccatgcgctgctgggcgcgatg
ctcggcgtcggcgtcgccagcagcctgctgaacggtcagggggcgctggcaggcatcgac
tggcgtcaggcgggctgggccggctgggcgctgctgctgtcgccgctgctgggctttctc
gccgctgccctgctgctgcggctgatgaaggtactgctgccgttgtcgctcacggcatcc
ggcgcgccggcggaacgccctccgctctggctgcgcggtatgctgatcctgaccagcagc
ggcgtttcgtttgctcacggcgctaacgatggtcagaaaggcatggggctgatgatggtg
atcctgttgatcgcgctgccgggcgctttcgccctcaaccgcgcgatgccggaacgcgaa
ctggccgatctgacgctgctgacgacgcaggcgcaggcacagctgccgcagcgcgccggc
ctctcactgacgtcggcgcaggcgatactggataattcgcgccagcagcagggagcgcgc
gacggcgtgttaccggcgctgggggcgatgaccgccagcctgcatcagcagctgagcggg
ataaaacggctcagcgagctaccaccggcagaaactgcggcgctgcgcctgcgtatgacg
ctgactgccgacgcgctacagcggctgctggcgcaggagaacccgctctccggcagccag
cgcgcgctactggccagcctgaccgcgcagcttaagcacgccagcagcgtgatcccgtgg
tgggtaaaaatcgtggtggcgctggcgctggggcttggcacgctgacgggctggcagcgc
attgccatcactattggtgagcgcaccggtaaagcgccgctgacgccgatacagggcgcc
agcagcgagctggtggccatgaccacgctgggcgtggcagaacagttcggcctgccggtc
tctaccactcaggtgctgacctgcggcgtagcgggtagcatggtggcgagccgcagcccg
ctgcagcctcgtaccctgaaacgcatgggactggtgtggctgctgacgctgccggtctgc
gcgctgctctccgccctgctttatgcgctgtttatcgccctgtag

DBGET integrated database retrieval system