KEGG   Mixta gaviniae: C2E15_07500Help
Entry
C2E15_07500       CDS       T05418                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pgz  Mixta gaviniae
Pathway
pgz00260  Glycine, serine and threonine metabolism
pgz01100  Metabolic pathways
pgz01110  Biosynthesis of secondary metabolites
pgz01120  Microbial metabolism in diverse environments
pgz01130  Biosynthesis of antibiotics
pgz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C2E15_07500
Enzymes [BR:pgz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C2E15_07500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1 TetR_C_20
Motif
Other DBs
NCBI-ProteinID: AUX92939
UniProt: A0A1X1DVC4
Position
complement(1613317..1614318)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSPAMLSAMVSARTGDDVYGDDPTVNALEAEAARLSGKAAALFLPTGTQ
ANLVALLTHCERGEEYIVGQQAHNYKYEAGGAAVLGSIQPQPIEAAEDGTLPLAKVAACI
KPDDIHFARTRLLSLENTIGGKVLPVDYLAEAYRFTREHQLALHIDGARIFNAAVALELE
LSALSRYCDTLTICLSKGLGAPVGSLLCGDEAYIQRARRWRKMTGGGMRQAGILAAAGLY
ALENNVMRLQEDHDNARWLAEQLGTLGLTVTQHTNMVFAQLPAEQVAPLKAWMQAHNILI
PAAPVTRLVTHLDVDRAALTQVINQWRAFLAAQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatttacgcagtgatacggtaacccgcccatcgccggcgatgctgtcggccatg
gtttccgcccgcaccggcgatgatgtctatggcgacgatcccaccgtcaacgcgctggaa
gcggaggcggctcgcctgagcggcaaagcggccgcgctctttttacccaccggcacccag
gcgaaccttgtcgccctgctcacccactgtgagcgcggcgaggagtatatcgtcggccag
caggcgcataactacaaatatgaggcaggcggcgcggcggtgctgggcagcattcagccg
cagccgatcgaggcggcggaagatggcacgctgccgctggcgaaggtcgccgcctgtatc
aagcctgacgatatccatttcgcacgtacgcgcctgctgagcctggagaacaccatcggt
ggcaaggtgctgccggttgattatctggccgaggcgtaccgcttcacgcgtgaacatcag
ctggcgctgcatatcgacggcgcgcgcatctttaacgccgccgtagcgctggagctggag
ctgagcgccctctcccgctactgcgataccctaaccatctgcctgtcgaaagggctgggc
gcgccggtaggatcgctgctgtgcggcgatgaagcctacattcagcgcgcgcgacgctgg
cgtaaaatgaccggcggcggcatgcgtcaggcgggcattctggcggcggcggggctttac
gcgctggaaaacaacgtgatgcgtctgcaggaggatcatgacaacgcccgctggctggcg
gagcagcttggcacgctgggcctgacggtcactcagcacaccaatatggtgttcgcgcag
ctgccggcggagcaggtggccccgctgaaggcgtggatgcaggcgcacaacattctgatc
ccggcagcaccggtaacgcgtctggtcacccatctggacgtcgaccgcgcggcgctcacg
caggtgatcaaccaatggagagcgtttctcgcggcgcagtaa

DBGET integrated database retrieval system