KEGG   Mixta gaviniae: C2E15_12290Help
Entry
C2E15_12290       CDS       T05418                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pgz  Mixta gaviniae
Pathway
pgz00561  Glycerolipid metabolism
pgz00640  Propanoate metabolism
pgz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C2E15_12290
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    C2E15_12290
Enzymes [BR:pgz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     C2E15_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 ASL_C DHQ_synthase PFK PEP-utilizers
Motif
Other DBs
NCBI-ProteinID: AUX93779
UniProt: A0A2L0IGZ4
Position
2628564..2629661
Genome map
AA seq 365 aa AA seqDB search
MSKFVFSSPRKYVQGAGVLAELGTYLKELGDNAFLIADEVVWGLVGEQVQTTLRQAGVEQ
RYEKFNGEASGNEISRLAGVARESGAPVVVGLGGGKTLDTAKAVADELHAPVVIVPTAAS
TDAPCSALSVIYSDSGVFESYRFYSKNPDLVLVDTWVCAQAPVRLFASGIADGLATYVEA
QAVLRSHGKSMVNGDPTIAGMAIARACEETLLTWGYSAWTAVAQKRVTPAVEAVVEANTL
LSGLGFENAGLAGAHAIHNGFTAIEGDIHHLTHGEKVAYGTLTQMVLEQRPDEEIARYIR
FYRAINMPTTLEEMHLENESWENLVKVGALANSEGDTLKNLNPGLTPEAVAHAILAVDAF
SKTVK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtttgttttttcctcaccgcgaaaatatgttcagggcgccggcgtgctggca
gaactgggcacctacctgaaagaactgggtgacaacgcctttctgatcgccgatgaggtg
gtctgggggctggtaggcgagcaggtgcaaaccaccctgcgtcaggctggcgttgagcaa
cgctacgagaagttcaacggcgaagcctccggcaatgaaatcagccgtctggcgggcgtt
gcgcgtgaaagcggcgccccggtagtggtgggcctcggcggcggtaagacgctggatacc
gcgaaggcggttgccgatgagttgcatgcgccggtagtgattgtaccgaccgccgcctcg
accgatgcaccctgcagcgcgctgtcagtgatctattccgacagcggcgtatttgaaagt
taccgtttttacagcaaaaaccccgatctggtgctggtggatacctgggtctgcgcgcag
gcgccggtgcgtctgttcgcctccggcatcgccgatggcctggcgacctatgttgaagca
caggcggtgctacgctcgcacggcaaatcgatggtgaacggcgatccgaccatcgccggc
atggctatcgcccgcgcctgcgaagagacgctgttgacctggggctacagcgcctggacc
gccgtggcgcagaagcgcgtcacgccggcagtggaggcggtagtggaagcaaatactctg
ctttccggccttggatttgaaaacgccggcctggcgggcgcgcacgccatccataacggc
tttaccgcgattgaaggcgatattcatcacctgacccacggcgagaaagtcgcctacggc
accctgacgcagatggtgctggagcagcgtccggatgaagagattgcgcgctatatccgt
ttctatcgcgccatcaatatgccgaccacgctggaagagatgcatctggaaaatgaaagc
tgggaaaatctggtgaaggttggcgcgctggcgaacagtgaaggcgatacgctgaaaaac
ctgaatcccggcctgacgccggaagcggtagcgcacgccatcctggcggtagatgccttc
agcaaaaccgtgaagtaa

DBGET integrated database retrieval system