KEGG   Mixta gaviniae: C2E15_17575Help
Entry
C2E15_17575       CDS       T05418                                 

Definition
(GenBank) amidohydrolase
  KO
K01451  hippurate hydrolase [EC:3.5.1.32]
Organism
pgz  Mixta gaviniae
Pathway
pgz00360  Phenylalanine metabolism
pgz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    C2E15_17575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pgz01002]
    C2E15_17575
Enzymes [BR:pgz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     C2E15_17575
Peptidases and inhibitors [BR:pgz01002]
 Metallo peptidases
  Family M20
   C2E15_17575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AUX94705
UniProt: A0A2L0IJI7
Position
complement(3756881..3758050)
Genome map
AA seq 389 aa AA seqDB search
MEQIYHHIMHSQDEFIALRRDLHQHPELGLEETRTSNIIVDRLRSWGYEVHRGMAKTGVV
GTLRVGSGGKTLGLRADMDALPMREQNDKPWRSITENRFHGCGHDGHTATLLCAAEYLAR
SRRFRGTLHLIFQPGEELLYGGRMMLEDGLFRQFPCDAIYALHNMPGIKKGHFHTRTGAM
LASADTLHIEVIGKGGHGAFPEKTTDATLVACQIVLALQTIVARNVSPFDRAVVTVGSLC
SGEAPNIINASALLKLSVRALDNSVRQHLLQRIQEIAQGQAQSFGAGVRIEHINGCPALI
NDADATAFAVGVARELVDEEMICTDAAPVMGSEDFAFMLEQNPRGGYLFLGAGDEPDRCM
VHHPGYDFNDELIAPGALFFSRLAERFLQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaacagatatatcatcatattatgcatagccaggatgagtttattgccctgcgccgc
gacctgcatcagcatcccgaattaggccttgaagagacgcgcaccagtaatattatcgtc
gacaggctgcgctcatggggttatgaagtgcatcgcggcatggcgaaaacgggcgtggtc
ggcacgctgcgcgttggcagcggcggaaagacgctggggctgcgtgccgatatggatgcg
ctgccgatgcgcgagcagaacgacaagccgtggcgcagcatcacagagaaccgctttcac
ggctgcgggcacgacggccataccgccacgctgctctgcgccgccgaatacctggcgcgc
agccgccgcttcaggggcacgctgcatctgatctttcagccgggcgaggagctgctctac
ggcggccgcatgatgctggaggatgggctgttccgccagttcccctgcgacgccatctac
gcgctgcacaatatgcccgggattaaaaaagggcattttcatacccgcaccggcgctatg
ctcgcctccgccgatacgctgcatattgaagtgatcggcaagggcggccacggcgccttc
ccggaaaaaaccaccgacgccacgctggtggcctgccagattgtgctggcgctgcagacc
atcgttgcacgcaacgtttcccccttcgatcgggccgtcgttacggtcggcagcctctgc
tccggcgaggcgcctaacatcattaacgccagcgcgctgttaaagctgagcgtgcgcgcg
ctggataacagcgtgcgccagcatctgctgcagcgtattcaggagatcgctcagggccag
gcgcagagcttcggcgccggggtgcgcatcgagcatatcaacggctgcccggcgctgatc
aacgatgccgacgccacggcgttcgccgtcggggtggcgcgcgagctggtggacgaggag
atgatttgcaccgatgccgcgccggtgatgggcagtgaagatttcgcctttatgctggag
cagaatccgcgcggcggctacctgtttctcggtgccggggacgagccggatcgctgcatg
gtgcatcatcccggctacgactttaacgatgagctgatcgcgcccggcgccctctttttc
agccgcctggccgaacgctttttgcaatag

DBGET integrated database retrieval system