KEGG   Mixta gaviniae: C2E15_18470Help
Entry
C2E15_18470       CDS       T05418                                 

Definition
(GenBank) class 1 fructose-bisphosphatase
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
pgz  Mixta gaviniae
Pathway
pgz00010  Glycolysis / Gluconeogenesis
pgz00030  Pentose phosphate pathway
pgz00051  Fructose and mannose metabolism
pgz00680  Methane metabolism
pgz01100  Metabolic pathways
pgz01110  Biosynthesis of secondary metabolites
pgz01120  Microbial metabolism in diverse environments
pgz01130  Biosynthesis of antibiotics
pgz01200  Carbon metabolism
Module
pgz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2E15_18470
   00030 Pentose phosphate pathway
    C2E15_18470
   00051 Fructose and mannose metabolism
    C2E15_18470
  09102 Energy metabolism
   00680 Methane metabolism
    C2E15_18470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgz04147]
    C2E15_18470
Enzymes [BR:pgz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     C2E15_18470
Exosome [BR:pgz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C2E15_18470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-ProteinID: AUX94860
UniProt: A0A2L0IJV0
Position
3943903..3944910
Genome map
AA seq 335 aa AA seqDB search
MKTLGEFIVEKQHDFPHATGELTALISAIKLGAKIIHRDINKAGLVDILGASGVENVQGE
QQMKLDLFANEKLKAALKARGIVAGIASEEEDEIVIFEGVENGKYVVLMDPLDGSSNIDV
NVSVGTIFSIYRRVTPPGTPVTEADFMQPGNKQVAAGYVVYGSSTMLVYTTGCGVHAFTY
DPSLGVFCLSQERMTFPEKGYTYSINEGNYIRFPQGVKKYLKFCQEEDKATHRPYTSRYI
GSLVADFHRNLLKGGIYLYPSTASHPSGKLRLLYECNPMAFLAEQAGGKASDGKNRILDL
QPEALHQRCPFFVGNDAMVEDVERFIREYPDNHQA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaggcgaatttatcgtcgagaagcaacacgactttccgcacgccactggt
gaactgaccgcgctgatttccgctattaagctgggcgctaaaattattcatcgcgatatt
aataaagccggtttggttgatatcctcggcgccagcggcgtggaaaacgtgcagggcgag
cagcagatgaagctcgatctgttcgccaacgaaaagctgaaggcggcgctgaaagcgcgc
ggcatcgtggccggcatcgcttctgaggaagaagacgaaatcgtcattttcgaaggcgtg
gaaaacggtaagtacgtagtactgatggatccgctggacggctcgtccaatatcgacgta
aacgtttccgtcgggacaattttttctatctatcgccgcgtgacgccgccaggcaccccg
gtcactgaagcggactttatgcagccgggcaacaagcaggtcgccgccggctatgtggtc
tatggctcgtcaaccatgctggtttacaccaccggctgcggcgtccacgcctttacttac
gatccgtcgctgggcgttttctgcctgagccaggagcgcatgactttcccggagaagggt
tacacctactccattaacgaaggcaactacattcgtttcccgcagggcgtgaagaaatac
cttaagttctgtcaggaagaagataaggcgacccaccgtccttatacatcacgctatatc
ggctcgctggtggcggatttccaccgcaacctgctgaagggcggcatctatctctacccc
agcaccgccagccaccccagcggcaagctgcgtctgctctatgagtgcaacccgatggcg
ttcctcgccgaacaggcgggcggcaaagcgagcgacggcaaaaaccgtattctcgatctg
cagccggaagcgctgcatcagcgctgcccgttctttgtcggcaacgacgcgatggtcgag
gatgtcgagcgctttatccgcgaatatccggataatcatcaggcctga

DBGET integrated database retrieval system