KEGG   Pseudoalteromonas haloplanktis: PSHAa0275Help
Entry
PSHAa0275         CDS       T00282                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00230  Purine metabolism
pha00250  Alanine, aspartate and glutamate metabolism
pha01100  Metabolic pathways
Module
pha_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PSHAa0275 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSHAa0275 (purA)
Enzymes [BR:pha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     PSHAa0275 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CAI85374
UniProt: Q3IEZ3
Position
I:289024..290337
Genome map
AA seq 437 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKVVDLLTDKASLVVRYQGGHNAGHTLVIDGEKTVLHLIPSGV
LRDNVKCVIGNGVVLSPEALMREIGMLEARGVPVRERLLISAACPLILPFHVALDVARET
ARGDKPIGTTGRGIGPAYEDKVARRGLRVGDLFNPELFAAKLEEVLEYHNFTLVNYYKVD
AVDFQKTFDDAMAVADILKAMIVDVTELLDQTRLAGDNILFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGAGFGPLHLDYVLGIIKAYTTRVGSGPFPTELYDGLDKQDPVGKHLGDK
GHEFGATTGRLRRTGWLDAVAMRRAVQINSISGFCLTKLDVLDGLETLKICTGYKLEDGT
VTNVTPLAAEGYEKVTPIYEEMPGWSENTVGVTSLDGLPKAAIDYVKRIEELTGVPVDII
STGPDRVETMILRNPFA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaaacgttgttgtattaggcacccaatggggtgacgaaggtaagggtaaggta
gttgacctccttacagataaagcatctttagtagttcgttatcaaggtgggcacaatgct
ggccataccttagtgatcgacggtgaaaagacagttctgcaccttattccatcgggtgta
ttacgtgacaatgttaaatgtgtgattggtaatggtgttgtattatcaccagaagcgcta
atgagagagattggcatgttagaagcacgtggcgtacctgtacgcgagcgtcttttaatc
agtgctgcatgtccattaattttgcctttccatgttgcattagatgtagcccgtgagact
gcacgtggtgataagccaattggtacaactggccgtggtatcggtcctgcgtacgaagat
aaagtggcacgtcgtggtttgcgcgtaggggatttatttaatcctgaactattcgcagca
aaactagaagaagttcttgaataccataactttactttagttaattactataaagtagat
gctgttgattttcagaaaacctttgatgacgcaatggccgttgctgatattttaaaagcg
atgattgttgatgttactgagcttttagatcaaacgcgtttagctggcgacaacattttg
tttgaaggcgcacaaggtacgttacttgatatcgatcatggtacttacccttatgtaacg
tcttctaacactacagctggtggcgttgctactggtgctggttttggcccactacacctt
gattatgtgcttggtattattaaagcatatactacacgtgttggttcaggcccttttcct
acagagctttacgacggccttgataagcaagacccagttggtaagcacttaggcgataaa
ggccatgagtttggcgcaaccactggtcgacttcgtcgtactggttggttagatgccgta
gcaatgcgtcgtgcagtgcaaatcaatagtatttctggtttttgtttaactaagcttgat
gttttagatggcttagaaacacttaaaatctgtactggttataagcttgaagatggcaca
gttactaacgtaacgccattagcagctgaaggttacgaaaaagtaacgccaatatacgaa
gaaatgcctggttggtcagaaaatactgttggtgtaactagccttgatggtttaccaaaa
gcagcgattgattacgttaagcgtattgaagagctcacaggtgttcctgttgatattatt
tctactggtcctgatcgtgtagaaactatgatacttcgcaatccgtttgcgtaa

DBGET integrated database retrieval system