KEGG   Pseudoalteromonas haloplanktis: PSHAa0392Help
Entry
PSHAa0392         CDS       T00282                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00010  Glycolysis / Gluconeogenesis
pha00020  Citrate cycle (TCA cycle)
pha00620  Pyruvate metabolism
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
pha01200  Carbon metabolism
Module
pha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSHAa0392 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSHAa0392 (aceF)
   00620 Pyruvate metabolism
    PSHAa0392 (aceF)
Enzymes [BR:pha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSHAa0392 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: CAI85490
UniProt: Q3IIH7
Position
I:407126..409090
Genome map
AA seq 654 aa AA seqDB search
MSIEIKVPDIGGDEVEVTEILVAVGDVVEVDQALLTVEGDKASMEVPADTAGTVKEIKVS
VGDNVATGSLVFIFEGESEGESADKSASADKSDSAAEQKTPATDAKPAPAASGSTAQDVT
LPDIGDDEVEVTEILVAVGDSVSEDQSILSVEGDKASMEVPAPFAGTVKEIKVATGDTVK
TGSLVFVFEVAGSESAAPAAESTPAETKAAPAAEQSSVSSTKEVNVPDIGGDEVEVTEVL
VAVGDSVTEDQSLLNVEGDKAAMELPAPFAGTVKEIKVATGDKVSTGSLIFVFEVAGGAP
AAAAKPEAEKSAPAAKSEKPAPKAETATQSAPAASNESFADNSAYAHASPVVRRLAREFG
INLANVKGSGRKNRVVKDDVQNYVKNLVKQVESGQLSADKGNAGGSELGLIPWPKVDFAK
FGEIEEKKLSRIQKLSGKNLHRNWVQIPHVTQFDEADITSLEEFRKEQNALNEKKKLGVK
ITPLVFVMKAAAKALAEFPTINSSLSNDGESLILKKYINIGVAVDTPNGLVVPVFKDVDK
KGIIELSRELMEVSAKARDGKLTSADMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVS
KSEMKPKWNGKEFEPKLMVPLSMSYDHRVIDGALAARFTVTLASYMSDIRQLVM
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaaattaaagtacccgatatcggtggtgatgaagtagaagtaaccgaaatc
ttagtagccgttggcgacgttgttgaagttgaccaagcattactaaccgttgaaggcgac
aaagcatcaatggaagtaccggccgacaccgctggcacagtaaaagagattaaagtaagc
gttggcgacaacgtagctactggatctttagtgtttatctttgaaggcgagagtgaaggc
gaaagtgcagataaaagcgcaagtgcagacaaaagcgacagtgcagcagagcaaaaaacg
cctgcaactgacgctaagccagcaccagcggcttctggctctacagcacaagacgtaacc
ttgccagatattggcgatgacgaagttgaagtaactgaaattttagtagccgttggtgac
agcgttagcgaagatcagtctattttaagcgttgaaggcgacaaagcatcaatggaagta
cctgcgccatttgctggcacagttaaagaaattaaagtagcgactggcgatacagtaaaa
accggttcattggtatttgtatttgaagtagcgggtagtgagtctgcagcaccagctgct
gagtcaacaccagccgaaactaaagcagcaccggcagccgagcaaagctcagtatcaagc
acaaaagaagttaacgtgcctgatattggtggcgacgaagttgaagtgaccgaagtttta
gtagccgttggcgacagcgttactgaagatcaatcgttactaaacgttgaaggcgacaaa
gcagcaatggagcttcctgcgccgtttgctggcacagttaaagaaattaaagtagctact
ggcgacaaagtatcgaccggctcgttaatttttgtttttgaagttgctggtggcgcacct
gctgcagccgctaaacctgaagccgaaaaatcagcacctgctgctaaaagcgaaaagcca
gcaccaaaagccgaaacagcgacgcaatctgctccagcagctagcaacgaaagctttgct
gataacagcgcgtatgcacatgcatcgcctgtggtacgccgcttagcacgtgagtttggt
ataaacctagctaacgtaaaaggctctggtcgtaaaaaccgcgtagtaaaagacgacgtg
caaaactatgttaaaaacttagttaagcaagttgaatctggtcaattgtcggcagataaa
ggtaacgcaggcggcagtgagcttgggcttattccatggcctaaagttgattttgctaag
tttggcgaaattgaagagaaaaaactatcgcgtattcaaaagctatcgggtaaaaactta
caccgtaactgggtgcaaatcccacatgttactcagttcgacgaagccgatataaccagc
cttgaagaattccgtaaagagcaaaatgcccttaacgagaagaaaaagctaggtgttaaa
attacgccattagtatttgtaatgaaagccgcagcaaaagcattggccgaatttccaact
attaactcgtcactgtctaacgacggcgaaagcttaattcttaaaaagtacattaatatt
ggtgtagcggttgatacgccaaatggtttagtagtacctgtgtttaaagatgttgataaa
aaaggcattattgaactatcgcgcgagctaatggaagtatcagctaaagcacgcgacggt
aagcttacctcggcagatatgcaaggtggctgttttactatttcaagcttaggcggtatt
ggcggtacggcatttacgccgattgttaacgcgccagaagtggctattttaggtgtgtct
aaatctgaaatgaagccaaaatggaatggtaaagagtttgaaccaaaacttatggtgcca
ttgtcaatgtcgtacgaccatagagtgattgacggtgcgctagcagcacgctttactgtt
acgctggcaagctacatgagcgatattcgtcaattagtgatgtaa

DBGET integrated database retrieval system