KEGG   Pseudoalteromonas haloplanktis: PSHAa0871Help
Entry
PSHAa0871         CDS       T00282                                 

Gene name
folP
Definition
(GenBank) Dihydropteroate synthase (DHPS) (Dihydropteroate pyrophosphorylase)
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00790  Folate biosynthesis
pha01100  Metabolic pathways
Module
pha_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSHAa0871 (folP)
Enzymes [BR:pha01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PSHAa0871 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Amidohydro_2 BBS2_C
Motif
Other DBs
NCBI-ProteinID: CAI85952
UniProt: Q3IE62
Position
I:897823..898668
Genome map
AA seq 281 aa AA seqDB search
MNNLLNLPRKRTLSLANPVIMGILNVTPDSFSDGGKFIDPDIALQRALQLLDDGAQIIDI
GGESTRPGAPDVSLEDELARVIPAIKAIRENSDCVISIDTSKAQVMHQAILAGADIVNDV
RALQESDALNVVAQFPDVAVCLMHMQGQPRSMQAAPHYDDLFTDIKQFFSQRIAACKTAG
IKQTQLILDPGFGFGKTLSHNYQLLAQFNDFTQFGLPLLAGLSRKSMIGNLLNRNTNERL
AGSLAGALIAAQNGAHIIRVHDVKETADVLNVLQACKQGVL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttactaaacttgcctcgcaaacgtacactaagtttggcaaatccagtaatt
atgggaatacttaatgttactcccgattcattttcagatggcgggaagtttatagaccct
gatattgcgctgcagcgtgcgctgcaattgttagacgacggggcgcaaattatagatatt
ggcggagagtcgactcgcccaggtgctcctgatgtgagccttgaggatgaattagcacgt
gtaataccagcgattaaagcaattcgtgaaaacagtgattgcgttatatctattgatacc
agtaaagcacaagtaatgcaccaagctattttagctggggccgatattgttaatgacgta
cgtgcattacaagaaagcgacgcactgaacgtagtggcgcagtttcctgatgttgcggtg
tgtttaatgcatatgcaaggccaacctcgcagcatgcaggcagcgccgcactatgatgat
ttatttacagatataaaacagttttttagtcagcgtattgctgcgtgtaaaacagcgggg
attaagcaaacacaacttattcttgatcctggctttggttttggtaaaacactcagccac
aattaccaactactggcgcagtttaatgactttactcagtttggtttaccgttattagcg
ggattatcgcgtaagtcgatgattggcaacttattaaatagaaatacaaatgagcgattg
gccggcagtttagcgggcgcattaatcgcagcacaaaatggtgcgcatattattcgtgta
cacgacgtaaaagaaaccgcagatgtacttaacgtactacaagcctgcaaacaaggagta
ctttaa

DBGET integrated database retrieval system