KEGG   Pseudoalteromonas haloplanktis: PSHAa0893Help
Entry
PSHAa0893         CDS       T00282                                 

Gene name
tesD
Definition
(GenBank) putative hydrolase acting on oxygenated substrates (epoxide hydrolase)
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00984  Steroid degradation
pha01100  Metabolic pathways
pha01120  Microbial metabolism in diverse environments
pha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    PSHAa0893 (tesD)
Enzymes [BR:pha01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     PSHAa0893 (tesD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Ndr DUF2220 BAAT_C
Motif
Other DBs
NCBI-ProteinID: CAI85974
UniProt: Q3IE89
Position
I:complement(923526..924428)
Genome map
AA seq 300 aa AA seqDB search
MSVHYLVSKAKLGVRVLNQQTTNPEKAQDLPLPLGHFVTLENGLKLHYLEQGQGPIVIWL
HGSGPGASGFSNFKGNYPEFADAGYRNIVLDLPGFGRSDKPDDVNYDLAFFVTALNGFIN
ALDLPKVTLLGNSLGGAIALGQALDYPDTVERLILMAPGGVEERETYFQMEGIVRMVEVY
SRGPMGVNQMREVMSLQLFDSAVLSDDILAERAAVAVTQPANLFSTMMVPNMTERLGELN
CPVLGFWGTNDKFNPHQGMHKILDNVPTARFIMLNRCGHWVQVEHQRLFNSSCIDFLQHG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttcattaccttgttagcaaggcaaaattaggagtaagagttttgaatcagcaa
acaactaatccagagaaagcacaggatttaccgttaccactgggacactttgttacccta
gaaaacggccttaaattacattatttagagcaaggccaaggccctattgttatttggctt
catggtagtggcccaggtgccagtggttttagtaactttaaaggcaattatcctgaattt
gctgatgcgggctatcgtaatattgtgctcgacttacctggttttggtcgctcagataaa
cccgatgacgttaattacgatttagctttttttgtcacagcacttaatggttttataaac
gcccttgatttacctaaggtgactttattaggcaattctttaggcggtgctattgcgctg
gggcaagctctcgattatcccgatacggtagagcgcctaattttaatggccccgggtggt
gttgaagagcgcgaaacgtattttcaaatggaaggtatagtgcgtatggtagaagtatac
agccgtggccctatgggagttaaccaaatgcgcgaagtgatgtcgttacaactttttgat
tcagctgtactttctgatgatatattagcagagcgcgctgcagtggcagtaactcaaccg
gctaatttatttagcactatgatggtgccaaacatgaccgaacgccttggcgagcttaac
tgcccagtgcttggcttttggggcactaacgataaatttaatccacatcaaggcatgcat
aaaattttggataacgtaccaacagcgcgctttattatgcttaatcgttgtggtcattgg
gtacaagtagaacatcaacgcctgtttaacagcagctgtattgattttttacaacacggc
taa

DBGET integrated database retrieval system