KEGG   Pseudoalteromonas haloplanktis: PSHAa1337Help
Entry
PSHAa1337         CDS       T00282                                 

Definition
(GenBank) putative 23S rRNA m1G745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
pha  Pseudoalteromonas haloplanktis
Brite
KEGG Orthology (KO) [BR:pha00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pha03009]
    PSHAa1337
Enzymes [BR:pha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     PSHAa1337
Ribosome biogenesis [BR:pha03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PSHAa1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_32 MTS Methyltransf_12 PrmA Methyltransf_33 FtsJ MetW TPMT Methyltransf_4 Methyltransf_9 Methyltransf_18 CMAS Ubie_methyltran NodS tRNA_U5-meth_tr AdoMet_MTase Pox_MCEL
Motif
Other DBs
NCBI-ProteinID: CAI86412
UniProt: Q3IL14
Position
I:complement(1385623..1386444)
Genome map
AA seq 273 aa AA seqDB search
MSLEYSCPLCSNLLIKTANMLRCENNHSFDFAKEGYVNLLPVQQKNSKQPGDSLEMVQAR
RAFLERNYYAFLQHELGQIISNIAANNIIDLGCGEGFYTQALASNTQATVYGVDISKAAV
KYAAKRYSNCHFSVASISQAPFKSYFADVLVSVFAPLFTQELARLAKPGSTLVVASPGPQ
HLKELKEYIYSSVNEHTQIEVPAMFTQTSQTLITEQVTLNFSDVKNLIMMTPFAWKFRPE
HWLALEEKGEHNVTLSFYITQFTRDKSIAVAHI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgaatatagctgcccactgtgtagcaacttactaataaaaacagctaatatg
cttcgctgtgaaaacaaccatagttttgactttgcaaaagaaggctatgtaaatttattg
cctgtacagcaaaaaaactcaaaacaacctggtgactcattagaaatggtgcaagctagg
cgcgcttttttagagcgcaactattatgcctttttacagcacgaacttggccaaattatt
agtaatatagcagctaataatattattgacttagggtgtggtgaaggattttatacccaa
gctttagctagtaatacccaagctactgtgtacggggttgatatatcgaaggcggcggta
aaatatgcggcaaaacgctacagcaattgtcactttagcgtggcatccattagccaagca
ccttttaaaagctactttgccgatgtattggtcagtgtattcgcaccattatttactcaa
gaactagcaagacttgctaaacccggttcaacactcgtagtggcaagccccggacctcag
catttaaaagagttaaaagagtatatttactcaagtgttaatgaacatacacaaatagaa
gtacctgcaatgtttacacaaacatcgcaaacactcatcactgagcaagttaccttaaac
tttagcgacgttaaaaacttaataatgatgacaccattcgcgtggaagttcagacccgag
cactggttagcactcgaagaaaaaggtgaacataatgtcaccttatcgttttatattaca
caattcacaagagataaaagcatagctgttgcgcacatataa

DBGET integrated database retrieval system