KEGG   Pseudoalteromonas haloplanktis: PSHAa1586Help
Entry
PSHAa1586         CDS       T00282                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain, Acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00071  Fatty acid degradation
pha00072  Synthesis and degradation of ketone bodies
pha00280  Valine, leucine and isoleucine degradation
pha00310  Lysine degradation
pha00362  Benzoate degradation
pha00380  Tryptophan metabolism
pha00620  Pyruvate metabolism
pha00630  Glyoxylate and dicarboxylate metabolism
pha00640  Propanoate metabolism
pha00650  Butanoate metabolism
pha00900  Terpenoid backbone biosynthesis
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
pha01200  Carbon metabolism
pha01212  Fatty acid metabolism
pha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSHAa1586 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSHAa1586 (atoB)
   00640 Propanoate metabolism
    PSHAa1586 (atoB)
   00650 Butanoate metabolism
    PSHAa1586 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSHAa1586 (atoB)
   00072 Synthesis and degradation of ketone bodies
    PSHAa1586 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSHAa1586 (atoB)
   00310 Lysine degradation
    PSHAa1586 (atoB)
   00380 Tryptophan metabolism
    PSHAa1586 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSHAa1586 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSHAa1586 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSHAa1586 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pha04147]
    PSHAa1586 (atoB)
Enzymes [BR:pha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSHAa1586 (atoB)
Exosome [BR:pha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSHAa1586 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAI86659
UniProt: Q3IGQ0
Position
I:1652439..1653632
Genome map
AA seq 397 aa AA seqDB search
MTKFNNNSVVILSAVRTAIGGFGGSLKNFTPAQLGTMCAKEALARANISPKQVGSCVVGK
VIHNGPKDAYLSRVIGLDAGLPISSHAVTLNRLCGSGLEAIIQAAQQIQLGDVNAALAGG
AESMSSSGYTLASNRWGQKMGDSTVVDELTTTLQDPWDNTPMGVTAESIAEKYSISRKQQ
DAYAAQSHHKAAKAITAGYFKQQIMPIEIKSRNGNQIFDTDEHVRADTTVEKLATLKPYF
KQNGTVTAATSSGINDGAAMLVLMSEQKANEQGLKPLGRLVGYARAGVEPSLMGTGPIPA
VQQVFDKTGLTIDDMDVIESNEAFAAQALCVGNELNFPEHRVNPNGGAIALGHPVGATGA
ILSTKCLYELKRINGKYGLVTMCIGGGQGIAAIFEAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttaataacaatagcgtagtaatattaagcgcagtacgcactgctatcggt
ggctttggtggcagccttaaaaacttcactcccgctcagttaggcactatgtgcgccaaa
gaagcattagccagagccaatatttcaccaaagcaagttggttcatgtgtggtaggtaaa
gtgatacataacggtcctaaagacgcgtatttgtcgcgagttattgggctagatgcaggg
ttaccaattagcagtcacgcggtaacactcaaccgcttgtgtggttcgggtttagaagcc
attatacaagcagcacaacaaattcaattaggtgatgtaaacgcagcattagcaggcgga
gcagaaagcatgagtagctcaggctatactctagcaagtaatcgttggggccaaaaaatg
ggtgatagtacagtagttgatgagctaactaccacattacaagacccatgggacaacaca
cctatgggcgttaccgctgaaagcattgcagaaaaatatagcattagccgcaagcaacaa
gacgcttacgcagcacaaagccatcataaagcggctaaagccattaccgcaggctatttt
aaacagcaaataatgcccatcgaaattaaatctcgtaacggtaatcaaatttttgatact
gacgagcatgttcgtgctgacacaacggtcgaaaaactcgccaccttaaaaccctacttt
aaacaaaatggtacagtcaccgcagccacctcatcaggtattaatgatggcgcagccatg
ttagtgcttatgtcggagcaaaaggccaatgaacaaggcttaaaaccactcggtcgccta
gtcggttatgccagagcaggtgttgagccttcattaatgggcacagggcctattcctgct
gtgcaacaggtgtttgacaaaactggattaactattgatgacatggacgtaatagaatca
aacgaagcctttgccgcacaggcattatgcgtaggcaatgagttaaactttcctgagcat
agagtaaaccccaatggcggagctatagcacttggccaccctgttggcgcaaccggtgct
attttatcgaccaaatgcctgtacgaactgaaacgcattaacggtaaatacggcttagtc
actatgtgtattggtggcggacaaggtatagctgctatttttgaagcgctttag

DBGET integrated database retrieval system