KEGG   Pseudoalteromonas haloplanktis: PSHAa2966Help
Entry
PSHAa2966         CDS       T00282                                 

Definition
(GenBank) conserved protein of unknown function
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00010  Glycolysis / Gluconeogenesis
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSHAa2966
Enzymes [BR:pha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSHAa2966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAI88001
UniProt: Q3IJZ2
Position
I:complement(3150592..3151446)
Genome map
AA seq 284 aa AA seqDB search
MKLSPSVSICHTDTGLEFININSSHCDAKIFLQGGQITEFTPKGKQPLLWVSQEETFQEN
ASIRGGIPICWPWFGAHDNSDFPAHGFARTSLWQADEVHETEYEVIVSLKLPMKLVNLDY
WPHQSSLRVEFVLNEQLQVRLTTTNLSNTPFSFSQALHTYFPTSDINNTSVDGLQGAQYT
EFGEAPVMQSDVVSFARETDMVYTQAAPVQTINTPEGIISVGRENSSSCVLWNPWIEKSK
RLSNFANTEYNNMLCLEAANVLNDAVTLAPKQSHTLITIIKWLS
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatcaccttccgttagtatttgtcatactgacaccggtttagaatttattaat
ataaatagcagccattgcgatgcaaaaatatttttgcaaggcgggcaaattaccgagttt
accccaaaaggtaagcagccattgttatgggtatctcaagaagaaacattccaagaaaat
gccagtattcgcggcggtatcccaatttgttggccttggtttggagcacacgataacagc
gattttccggcgcatggttttgctcgaacgagtttgtggcaggccgatgaagtgcatgaa
accgaatacgaagttattgttagccttaaattacccatgaaactagttaatcttgattat
tggccgcatcaatcaagcttacgagttgagtttgtactaaacgagcagttacaagtgcgc
ttaacaaccacaaatttaagcaatacaccgtttagcttttcgcaagcgctgcatacttat
tttccaacatcagatattaacaataccagcgttgatggtttgcaaggtgcgcaatatact
gaatttggagaagctccagtaatgcaaagtgatgtggttagttttgcccgcgaaaccgac
atggtttatacccaagcagcgccagtgcaaaccattaatactcccgagggtataattagt
gtgggccgagaaaattccagctcttgcgtattgtggaatccatggatagaaaaatcaaag
cgtttatctaactttgctaatactgaatataacaacatgctttgccttgaagcagccaac
gtattaaatgatgccgttacgctcgcgccaaaacaaagccataccttaattaccatcatt
aaatggctgagttga

DBGET integrated database retrieval system