KEGG   Proteus hauseri: PH4a_03920Help
Entry
PH4a_03920        CDS       T05854                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
phau  Proteus hauseri
Brite
KEGG Orthology (KO) [BR:phau00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PH4a_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: QAV22531
UniProt: A0A410X741
Position
821619..821996
Genome map
AA seq 125 aa AA seqDB search
MFTSSKVAVQVQSVYIESQSSPDDQRYVFAYTVSIHNLNKCTIRLLRRYWLITNAQGHTT
EVQGEGVVGEQPLIEPGTQYRYTSGAVLETPMGTMEGHYEMIDADGRLFQIEIPVFRLAL
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgttcacctcatcaaaagtggcggtacaagtacaaagcgtttacattgaaagtcaatct
tcaccggatgaccaacgttatgtttttgcttacacagtatctattcataatttgaataag
tgtacaattcgcctcctgcgtagatattggttaattactaatgctcagggacataccact
gaagttcaaggtgaaggggttgttggtgaacagcctttaattgaacccgggacacaatat
cgctataccagtggtgcggttcttgaaacgccaatgggcactatggaaggccattatgaa
atgatagatgctgatggccgattatttcaaatagagatccctgttttccgtcttgcactt
ccgacattgataaactaa

DBGET integrated database retrieval system