KEGG   Proteus hauseri: PH4a_17745Help
Entry
PH4a_17745        CDS       T05854                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
phau  Proteus hauseri
Pathway
phau00250  Alanine, aspartate and glutamate metabolism
phau00330  Arginine and proline metabolism
phau01100  Metabolic pathways
phau01110  Biosynthesis of secondary metabolites
phau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:phau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PH4a_17745 (putA)
   00330 Arginine and proline metabolism
    PH4a_17745 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:phau03000]
    PH4a_17745 (putA)
Enzymes [BR:phau01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PH4a_17745 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PH4a_17745 (putA)
Transcription factors [BR:phau03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PH4a_17745 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH RHH_1 BAF
Motif
Other DBs
NCBI-ProteinID: QAV25080
UniProt: A0A410XEI1
Position
3857841..3861809
Genome map
AA seq 1322 aa AA seqDB search
MSSTTMGVRLDEETRNRLKNAAQKLDRTSHWLIKQAIFNYLEQIDNNQLVLTDSVLAAQD
IDENTDIPAMYYQPFLEFAEHIHPQSVLRSAITSAYRTPETQAVPMLLQQATLPENQAQA
THKLAYSIAEKLRKQKNGIGRSGLVQGLLQEFSLSSQEGVALMCLAEALLRIPDKATRDA
LIRDKISHGNWRSHVGQSQSMFVNAATWGLLFTGKLVSTHNEEKLSNSLNRILTKSGEPL
VRKGVDMAMRLMGEQFVTGETISQALANARKLEEKGFSYSYDMLGEAALTEKDAQDYLVS
YQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYERVMSELYPRLLSLTLQAKQY
DIGINIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPLVIDYVIDLAQR
SRRRLMVRLVKGAYWDSEIKRAQIDGLEDYPVYTRKVYTDVSYLACAKKLLSSPNFIYPQ
FATHNAHTLSAIYHLAGQNYYPGQYEFQCLHGMGEPLYAQVVGKIAEGKLGRPCRIYAPV
GTHETLLAYLVRRLLENGANTSFVNRIADTTISLDELVADPVKEVNKMAQTEGHVGLSHP
RIPLPDKLYGDERKNSQGLDMSNEHRLASLSSALLTSATEKMHCEPILGGEFSQPETSLI
SQSVLNPANHADIVGTVREATQAEADFALTIAQENGEIWFATPPAERAAFLIRAAQLMEQ
QMGPLMGILVREAGKTYNNAIAEVREAIDFLYYYAAQVEKDFDNNTHRPLGPVVCISPWN
FPLAIFSGQIAAALAAGNTVLAKPAEQTPLIAAKAIALFHQAGIPHAALQLLPGQGETIG
AHLVADDRVRGVMFTGSTAVAHILQKTLAGRLDSEGRPVPLIAETGGLNAMIVDSSALTE
QVVTDVMASAYDSAGQRCSALRILCIQEEVADHTIEMLKGAMAQANIGDPSLLSTDIGPV
IDKEAKIGIDRHIQAMRTEGRSVYQATHNSLPKHIENNSTFVQPTLIELDKVSSLKKEIF
GPVLHVVRYASQDLPTLLNEINATGYGLTMGVHTRIDETIAYIATHAKVGNLYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPAYLYRLLSKRPENATTQTLSRQDAYLPLDTSMRNSLL
QTYHNFMAWLVNKVEKTHYAALEDYAAASQTGTLRVLPGPTGERNTYQLVPCGNVLCIAD
NEKDGFSQIAGVLASGCHAIVVNSAFSQKTYRELPDDVRKSITLTDKWDDDSVKINAVIY
HGDCDQLKEICQKIAQRKGAIISVQGFARDETNLLLERLLHERALSINTAAAGGNASLMT
IS
NT seq 3969 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcacaacaatgggtgtcaggcttgatgaagaaacccgtaatcgattaaaaaat
gcggcacaaaaattagatagaacatcacattggttaattaaacaggcaatttttaattat
cttgaacaaattgataataatcagctggtattaacagattcagtgctcgcagcacaagat
attgatgaaaacactgatattccagcaatgtattatcaaccattcttagaatttgctgaa
catattcatcctcaatcagttttacgctcagcaattacttctgcttatcgcacaccagaa
acacaagcagttcctatgttattacaacaagcaacactgcctgagaatcaagcacaagca
acccataaactggcttattccattgcagaaaaactacgaaaacaaaaaaatggtattggt
cgttcgggactagttcaaggattgctacaagagttttcgctctcttctcaagaaggggtg
gctttaatgtgtctggctgaagctttattgcgtattccagataaagcaactcgagatgcg
cttattcgtgacaaaattagccatggaaattggcgttcacatgtaggccaaagccaatct
atgtttgttaatgctgcaacttggggattactttttactggaaaattagtttcaacacat
aacgaggaaaaactatctaattcactcaatcgtattttaactaaaagtggtgagccgctt
gtccgcaaaggcgttgatatggcaatgcgcttgatgggtgagcaatttgttaccggagaa
acaatttctcaggctcttgctaatgcgcgtaaattagaagaaaaaggatttagttattct
tatgacatgttaggtgaagctgctttaactgaaaaagatgcccaagattatttagtctct
taccaacaagcaattcacgcaattggtaaagcctctaatggtagaggtatttatgaaggc
ccgggaatttccattaaactatcagcattacatcctcgttatagccgtgcgcaatatgaa
cgtgttatgtctgaactttaccctcgcctgctttctttaacactgcaagctaaacaatat
gatatcggcataaatattgatgccgaagaagccgatagattagaaatctctctcgattta
ttagaaaaactctgttttgagccagaattagccggttggaatggtattggttttgttatt
caggcctaccaaaaacgttgtccattagtcattgattatgtaattgatttagcacaacgt
agccgtcgtcggttaatggttcgcttagttaaaggcgcatattgggatagtgaaattaaa
cgcgctcaaattgacgggcttgaagattatcctgtatatacccgcaaagtgtataccgac
gtttcttatcttgcttgcgcaaagaaattactgtcttcacctaattttatttatcctcag
tttgcaacacataatgcgcatactctttctgcgatctaccatttagctggacaaaactat
tatccgggtcaatatgaatttcaatgtttacatggtatgggcgaacctctctatgctcag
gttgtaggtaaaatagctgaaggtaaattaggtcgcccttgccgtatttatgcccccgtt
ggtactcatgaaacgttattagcttatttagtgcgtcgtttattagaaaatggagctaat
acttcatttgttaaccgtattgctgataccacaatttcgttagatgaactggtcgccgac
cctgttaaagaagtcaataaaatggctcaaacagaaggtcacgttggactttctcaccct
cgaattccactgcctgataagctttatggtgatgagcgtaaaaattctcaaggtcttgat
atgtcgaatgaacatcgtttggcatctctctctagtgccttgttaacgtcagcaacagaa
aaaatgcactgtgagccaatacttggtggtgaatttagtcaaccagaaacatcattaata
tctcaatcagtactaaacccagcaaatcatgccgatattgtaggaactgtccgcgaagca
acacaagctgaagctgattttgccttaacgatagctcaagaaaatggtgagatttggttt
gcaacaccaccagcagaacgcgctgcgtttttaattcgcgcggctcagttaatggaacag
caaatgggtccattaatggggatcctcgttcgagaagctggcaaaacgtataacaatgcg
atagctgaagtacgagaagcaatagattttctctattattatgccgctcaggttgaaaaa
gactttgataacaatacccatcggcctttagggccagtggtttgtattagcccttggaat
ttcccattagcaatattcagtggacaaattgctgcggcattagcggcaggaaataccgta
ttagccaaacctgctgagcaaactcctctaattgctgctaaagcaattgcattatttcat
caagcaggtattcctcacgctgcattacaattattaccagggcaaggcgaaacgattggc
gcacacttagttgctgatgaccgtgttcgtggtgtgatgtttactggctccaccgctgtt
gctcatattttacaaaaaacactagcgggtagattagatagtgaaggtcgtccagttcct
ttaatagccgaaactggcggcttaaatgccatgattgttgattcttcagcactcactgag
caagtagtaaccgatgtaatggcctccgcttacgatagtgcgggtcaacgctgctcagca
ttacgtattttatgtattcaagaagaagttgctgatcacacaattgaaatgcttaaaggt
gcgatggctcaagcaaatattggcgacccaagtcttttatcaaccgacattggtccagtt
attgataaagaagcaaaaataggtattgaccgccatatccaagcgatgcgtactgaaggg
cgttctgtttatcaagcgactcataatagtttgccgaaacatatcgagaacaatagtact
tttgttcaaccgactttaattgagttagataaagtcagttcactgaaaaaagagatcttt
ggtcctgttttacatgttgttcgctacgcaagccaagatttgcctactttattaaatgag
attaatgccacaggttatggtttaactatgggcgttcatactcgtattgatgaaactatt
gcgtatattgctactcatgcaaaagtaggaaacttatatgtaaaccgaaatatggtaggt
gctgtggtaggtgttcagccttttggtggtgaaggattatcaggtacggggcctaaagcg
ggtgggcctgcttatttatatcgcttattatctaaacgccctgaaaatgcgacaacacaa
accttatcgcgccaagatgcttatctccctcttgatacttcaatgcgtaatagtttgttg
caaacctatcataactttatggcatggttagtgaacaaagttgaaaaaacgcattatgct
gcattagaagattacgctgctgcctctcagacaggcacattgcgtgtattaccaggtccg
actggtgaacgtaatacttatcagttagttccttgtggcaatgtactttgcattgcagat
aacgaaaaagatggctttagccaaatagcaggagtattagcttcaggctgtcatgccatt
gtggttaacagtgcattctcgcaaaaaacatatcgtgaattaccggatgacgttaggaaa
tctatcactcttactgataaatgggatgatgattcagttaaaattaacgccgttatttat
catggtgattgcgatcaacttaaagaaatttgtcaaaaaatagcgcaacgtaaaggtgct
atcatttcagtacaaggattcgctagagatgagacaaatttattgttagaacgtttatta
cacgagcgagccctcagcattaatacggctgcagctggcggtaatgcaagcttaatgaca
attagctag

DBGET integrated database retrieval system