KEGG   Phenylobacterium sp. HYN0004: HYN04_04300Help
Entry
HYN04_04300       CDS       T05485                                 

Definition
(GenBank) 6-aminohexanoate hydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
phb  Phenylobacterium sp. HYN0004
Pathway
phb00330  Arginine and proline metabolism
phb00360  Phenylalanine metabolism
phb00380  Tryptophan metabolism
phb00627  Aminobenzoate degradation
phb00643  Styrene degradation
phb01100  Metabolic pathways
phb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    HYN04_04300
   00360 Phenylalanine metabolism
    HYN04_04300
   00380 Tryptophan metabolism
    HYN04_04300
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HYN04_04300
   00643 Styrene degradation
    HYN04_04300
Enzymes [BR:phb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     HYN04_04300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AWM77044
UniProt: A0A2Z3I0V5
Position
complement(900835..902265)
Genome map
AA seq 476 aa AA seqDB search
MTPEAYADLDGLGLAEAIRKGETTPLEAVDAAIAIIERRNPVLNAVVHTAFEEARRQALG
DLPDGPFRGVPFLIKDLAMPVAGWPRTSGSRFARHIVDREDGGLTARYRRAGVIPLGKTN
TPEYGITGTTESALLGPCRNPWNPGHIAGGSSGGSAAAVASGMVPMAHASDGLGSIRIPA
ACCGLVGLKVTRDRVPNLPDGFDYAAGFVVDHVVTRTVRDSAAMLDATDGPEPDSPYPAP
PKAGPYLAEVGRAPGRLRITWSSETVSGRPIDPQVQAALERTADLLRRLGHDVVEQGLGI
DYRALYAARGPVSGANFAAGMARLIDEIGREPEPDELEPLTWVSLKGGRKVTGEMALRSL
QELRMLNRATLAAFRDRDVHLTPVLGTPVPEIGFIDPVNLEPKEVNRRQGQVFPFTPPFN
FSGQPSLSLPLETTADGLPVGMMFTARYADEATLFRLAGQLEREAPWAGRRPGLWA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaagcgtacgccgacctcgacggccttggcctggcggaggccatccgcaag
ggcgagacgacgcccctggaggccgtggacgcggccatcgccatcatcgagcggcgcaat
cccgtcctgaacgccgtggtccacaccgccttcgaggaagcccggcgacaggcgctgggc
gacctgccggacggccccttccggggcgtgcccttcctgatcaaggacctggccatgccc
gtggccggctggccgcgcacctcgggcagccgcttcgcccggcatatcgtcgaccgcgag
gacggcggcctgaccgcccgctaccgccgggccggcgtcattcccctgggcaagaccaac
accccggaatacggcatcaccggcacgacggagagcgccctcctcggcccctgccgcaac
ccctggaaccccggccacatcgccgggggatcctcaggcgggtcggcggcggccgtcgcc
tccggcatggtccccatggcccacgccagcgatggcctgggctcgatccgcatccccgca
gcctgctgcggactggtggggctgaaggtcacccgcgaccgggtgccgaacctgccggac
ggcttcgactacgccgccggcttcgtggttgaccacgtggtcacccgcaccgtgcgcgac
agcgccgccatgctggacgcgacagacgggcccgagcccgacagcccctatcccgccccg
cccaaggccggcccctacctcgccgaggtgggccgggcgccgggccgcctgcggatcacc
tggtcctccgaaaccgtctccggccggcccatcgacccccaggtccaggcggccctggag
cgcaccgccgacctcctgcgccgcctcggacacgacgtggtcgagcagggcctgggcatc
gactaccgcgccctctacgccgcccgggggcccgtctcgggcgccaacttcgccgccggc
atggcccggctcatcgacgagatcggccgcgagcccgagcccgacgagctggagcccctg
acctgggtctccctcaagggcgggcgcaaggtgaccggcgagatggccctgcggtccctg
caggagctgcggatgctgaaccgggcgaccctggccgccttccgggaccgcgacgtccac
ctgacgccggtcctgggaaccccggtgccggagatcggcttcatcgacccggtcaacctc
gagccgaaggaggtcaaccggcgccagggccaggtcttccccttcaccccgcccttcaac
ttctccggccagccctccctgtccctgcccctggagaccaccgccgacggcctgccggtc
ggcatgatgttcaccgcccgctacgccgacgaggccaccctcttccgcctggccggccag
ctcgagcgcgaggcgccctgggccggacggcggccgggcctctgggcgtga

DBGET integrated database retrieval system