KEGG   Phenylobacterium sp. HYN0004: HYN04_08730Help
Entry
HYN04_08730       CDS       T05485                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
phb  Phenylobacterium sp. HYN0004
Pathway
phb00520  Amino sugar and nucleotide sugar metabolism
phb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HYN04_08730
Enzymes [BR:phb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     HYN04_08730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short UDPG_MGDP_dh_N KR NmrA
Motif
Other DBs
NCBI-ProteinID: AWM77841
UniProt: A0A2Z3HWY8
Position
complement(1824689..1825636)
Genome map
AA seq 315 aa AA seqDB search
MKRILVTGGAGFIGSHLCERLLEAGHEVLCVDNFYTGSRRNVAHLLGNPAFELMRHDVTF
PLFAEIDEVYNLACPASPVHYQFDPVQTTKTSVHGAINMLGLAKRRRAKIFQASTSEVYG
DPAVHPQTEDYWGNVNPIGIRSCYDEGKRCAETLFFDYHRQHGLRIKVARIFNTYGPRMH
PNDGRVVSNFIVQALQGQDITLYGEGLQTRSFCFVDDLVEGVLRLMDTPDDVTGPVNLGN
PGEFTIRALAERVIALTGSSSRLVHMPLPSDDPRQRRPDISLAGQLLDWKPTIELDEGLT
RTIAYFDNLLASEPV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcatcctggtcaccggcggcgcggggttcatcggctcacacctctgcgagcgc
ctccttgaggccggacatgaggtcctgtgtgtcgacaacttctacacgggctcgagacga
aacgtcgcccacctgctcggcaatcccgccttcgagctgatgcgccatgacgtgaccttt
ccgctctttgccgagatcgacgaggtctacaacctcgcctgtccggcatctccggtgcac
taccagttcgatccggtccagacgaccaagacgtccgtccatggggcgatcaacatgctg
ggcctggcgaagcgccggcgcgccaagatcttccaggcctccacaagcgaggtctatggg
gatcccgccgtgcatccccagaccgaggactattggggcaacgtcaacccgatcggcatc
cgctcctgctacgacgagggcaagcggtgcgccgagacccttttcttcgactatcaccgc
cagcacgggctgcggatcaaggtcgcgcggatcttcaacacctacggcccccgcatgcat
cccaatgacggccgggtggtttccaacttcatcgtgcaggccctccagggccaggacatc
accctctatggcgaggggctccagacgcggtcattctgcttcgtcgacgacctggtcgag
ggcgtccttcgcctgatggacacccccgatgacgtcaccggcccggtcaacctgggcaat
ccgggggagttcaccattcgcgccctcgccgagcgcgtcatcgccctgactgggtcttcc
tcacgcctggtgcacatgccccttccgtcggacgacccgcgccagaggcgaccggacatc
agcctggccggccagcttctcgactggaagccgaccatcgagctggacgagggcctgacc
cggaccatcgcctacttcgacaacctcctcgcgtcggaacccgtctag

DBGET integrated database retrieval system