KEGG   Phenylobacterium sp. HYN0004: HYN04_11680Help
Entry
HYN04_11680       CDS       T05485                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
phb  Phenylobacterium sp. HYN0004
Pathway
phb00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:phb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HYN04_11680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phb01007]
    HYN04_11680
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:phb03016]
    HYN04_11680
Enzymes [BR:phb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     HYN04_11680
Amino acid related enzymes [BR:phb01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   HYN04_11680
Transfer RNA biogenesis [BR:phb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HYN04_11680
 Prokaryotic Type
    HYN04_11680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AWM78349
UniProt: A0A2Z3I025
Position
2498319..2499716
Genome map
AA seq 465 aa AA seqDB search
MPLALYDSMARAKRPFVPADPARVTMYVCGPTVYNFAHIGNARPVVVFDVLFRLLRQAYG
EAAVVYAANVTDVDDKINRRAAEEGVPIDVITDRYLAAYNADMAELGALRPSLQPRATRT
MDAIIALIGRLVANGSAYAAEGHVLFDTQACGDYGALSGHPMEDMIAGARVDVAPYKRHP
ADFVLWKPSKPGEPVWDSPFGPGRPGWHIECTAMIEQSLGLPIDIHGGGIDLLFPHHENE
RAQGVCAHDPGADGDRTYARYWMHNGFLNFGEEKMSKSLGNVALVNDLIKSAPGEALRWA
LLVGHYRAPLEWTGDLIAQSVKALDRLYGALRRSAGIEAAETGPAQAFVAALEDDLNTPA
AMAELFGLATALETATGPGRAEAKGRLLASARLMGFLFGDPEAWFQGGADDALKARIDDL
VARRSEARAAKDWPAADQIRDELAALNVEVMDGPSGATWRLKERT
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcgccctctacgactccatggcccgcgccaagcggcccttcgtccccgccgat
ccggcccgggtgacgatgtatgtctgcgggccgacggtctacaatttcgcccacatcggc
aacgcccgccccgtggtggtgttcgacgtcctgttccgcctgctgcgccaggcctacggt
gaggccgccgtggtctatgcggcgaacgtcacggacgtggatgacaagatcaatcgcagg
gccgccgaggaaggcgtgccgatcgacgtcatcaccgaccgctacctggccgcctacaac
gccgacatggccgagttgggcgccctgaggcccagcctccagccccgggcgacgcggacc
atggacgccatcatcgccctgatcggccggctggtcgcgaacggctcggcctacgccgcc
gaggggcatgtcctgttcgacacccaggcctgcggcgactacggcgccctgtccggccac
ccgatggaggacatgatcgccggcgcccgggtggacgtggccccctacaagcgccatccg
gcggacttcgtgctctggaagccctccaagccgggcgagccggtttgggacagccccttc
ggccctggccggccgggctggcacatcgaatgcacggccatgatcgagcagtccctgggc
ctgcccatcgacatccacggcggcggcatcgacctgctcttcccgcaccatgagaacgag
cgggcgcagggggtctgcgcccacgaccccggcgccgacggcgaccgcacctacgcccgc
tactggatgcacaacggcttcctgaacttcggcgaggagaagatgtcgaagagcctgggc
aatgtcgccctggtgaacgacctcatcaagtcagccccgggcgaggcgctgcgctgggcc
ctgctggtcggccattaccgcgcacccctggagtggaccggcgacctcatcgcccagtcg
gtgaaggccctggatcggctctacggcgccctgcgccggtcggcgggaatcgaggcggcc
gaaaccggccccgcgcaggccttcgtggccgcactggaagatgacctcaacacccccgcc
gccatggccgagctgttcggcctggccaccgccctggagaccgcgacaggccctggacgg
gccgaggccaagggccggctgctggcctccgcccggctgatgggcttcctgttcggcgat
cccgaggcctggttccagggcggtgcggatgacgccctgaaggcccggatcgacgatctg
gtggctcgccggtcagaggcgcgcgccgccaaggactggccggcggccgaccagatccgc
gacgaactggccgccctgaacgtcgaggtcatggacggcccgtccggcgcgacctggaga
ctcaaggagaggacgtga

DBGET integrated database retrieval system