KEGG   Planococcus halocryophilus: BBI08_06085Help
Entry
BBI08_06085       CDS       T04473                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phc  Planococcus halocryophilus
Pathway
phc00071  Fatty acid degradation
phc00072  Synthesis and degradation of ketone bodies
phc00280  Valine, leucine and isoleucine degradation
phc00310  Lysine degradation
phc00362  Benzoate degradation
phc00380  Tryptophan metabolism
phc00620  Pyruvate metabolism
phc00630  Glyoxylate and dicarboxylate metabolism
phc00640  Propanoate metabolism
phc00650  Butanoate metabolism
phc00900  Terpenoid backbone biosynthesis
phc01100  Metabolic pathways
phc01110  Biosynthesis of secondary metabolites
phc01120  Microbial metabolism in diverse environments
phc01130  Biosynthesis of antibiotics
phc01200  Carbon metabolism
phc01212  Fatty acid metabolism
phc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBI08_06085
   00630 Glyoxylate and dicarboxylate metabolism
    BBI08_06085
   00640 Propanoate metabolism
    BBI08_06085
   00650 Butanoate metabolism
    BBI08_06085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBI08_06085
   00072 Synthesis and degradation of ketone bodies
    BBI08_06085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBI08_06085
   00310 Lysine degradation
    BBI08_06085
   00380 Tryptophan metabolism
    BBI08_06085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBI08_06085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBI08_06085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBI08_06085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phc04147]
    BBI08_06085
Enzymes [BR:phc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBI08_06085
Exosome [BR:phc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBI08_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANU13435
UniProt: A0A1C7DPP2
Position
complement(2065443..2066627)
Genome map
AA seq 394 aa AA seqDB search
MSQEIVIVSAVRTAVGSFQGSLKDVPATKLGEIVIKEVLKRASIQPDQVSEVIMGNVLQA
GLGQNPARQASINAGLPETVPAMTINKVCGSGLKSIQLAYQAIYAGDAEIVVAGGMENMS
RAPYLMENARSGFRMGDQKIVDSMLVDGLTCAFNDYHMGVTAENLCSRYDITREEQDKFA
ARSQARASAAIESGRFDDEIVPVEIPQRKGDPIIFKTDEYVKSSSNEDKLAKLRPAFKKD
GSVTAGNSSGINDGAAAVVVMSKAKAEELGLTPLATIVSSGTAGVDPAIMGIGPVQAVKN
ALAKANMSLGDIELIEANEAFAAQSISVDRELEFNHDILNVNGGAIAIGHPIGASGTRIF
VTLLHEMIKRDAKTGLATLCIGGGQGIATVIKRS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaatcgttattgtaagcgctgtccgaacagcggtaggttcatttcaaggg
tctcttaaagatgtcccagctacaaaattaggggaaatcgttattaaagaggtactaaag
cgtgcaagcattcaaccagaccaggtatcagaagtgattatgggaaatgtactccaagca
ggacttggtcaaaacccggctcgtcaagcgtcgattaatgcaggtctaccggaaactgtc
ccagcaatgaccatcaataaagtgtgtggctctggattaaagtccattcaattagcgtat
caagcaatttatgcaggggatgcagaaattgtagtagctggcggtatggaaaacatgagc
cgtgcgccttatttaatggaaaatgcgcgcagcggtttccgcatgggagatcaaaaaata
gtcgacagcatgcttgttgatggattgacatgtgcgttcaatgactatcacatgggcgtt
acagcagaaaatttgtgtagccgatatgatattacacgagaagaacaagataagtttgca
gcgcgttcacaggcacgtgcatcagctgcaattgaatcaggtcgctttgatgatgaaatc
gtaccggtggaaattccgcaacgtaaaggcgatccgatcatctttaaaacagatgagtac
gtgaagagtagctcgaacgaagataaattagccaagttgcgcccagcgttcaaaaaagat
ggtagtgtaacggcggggaactcatcgggcattaacgacggcgcagcagcagttgttgtg
atgtcgaaagcaaaagcagaggaactgggattaacaccgcttgcgacaatcgtatcaagt
ggaacagcaggagtggatccagctattatggggattggtcctgtacaagcagtgaaaaat
gcgttggctaaagcgaatatgtcactaggtgatattgagttgatcgaagcgaacgaggca
tttgcggctcagtcaatttcagttgaccgtgaactagaatttaaccatgatattttaaat
gttaatggtggagcgattgcgattggtcatccgattggtgcaagtggtacacgcatcttt
gttacgttattgcacgaaatgattaaacgtgatgcgaaaacaggtcttgcgactttatgc
attggtggcggccaaggaatcgcaacagtcattaaacgttcttaa

DBGET integrated database retrieval system