KEGG   Planococcus halocryophilus: BBI08_09380Help
Entry
BBI08_09380       CDS       T04473                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
phc  Planococcus halocryophilus
Pathway
phc00071  Fatty acid degradation
phc00072  Synthesis and degradation of ketone bodies
phc00280  Valine, leucine and isoleucine degradation
phc00310  Lysine degradation
phc00362  Benzoate degradation
phc00380  Tryptophan metabolism
phc00620  Pyruvate metabolism
phc00630  Glyoxylate and dicarboxylate metabolism
phc00640  Propanoate metabolism
phc00650  Butanoate metabolism
phc00900  Terpenoid backbone biosynthesis
phc01100  Metabolic pathways
phc01110  Biosynthesis of secondary metabolites
phc01120  Microbial metabolism in diverse environments
phc01130  Biosynthesis of antibiotics
phc01200  Carbon metabolism
phc01212  Fatty acid metabolism
phc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:phc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBI08_09380
   00630 Glyoxylate and dicarboxylate metabolism
    BBI08_09380
   00640 Propanoate metabolism
    BBI08_09380
   00650 Butanoate metabolism
    BBI08_09380
  Lipid metabolism
   00071 Fatty acid degradation
    BBI08_09380
   00072 Synthesis and degradation of ketone bodies
    BBI08_09380
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBI08_09380
   00310 Lysine degradation
    BBI08_09380
   00380 Tryptophan metabolism
    BBI08_09380
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBI08_09380
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBI08_09380
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBI08_09380
Enzymes [BR:phc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBI08_09380
Exosome [BR:phc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBI08_09380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU14054
UniProt: A0A1C7DRM6
Position
complement(2769174..2770367)
Genome map
AA seq 397 aa AA seqDB search
MAKTVIIDGARTAFGKFGGNLSTLSASDLGAEAIKAAMSRADIQLDDVQEVIMGNVLQAG
QGQIPSRQAATKAGIPYNVKSETINKVCASGMRSVTLADQIIRLGDEEVIVAGGMESMSN
APYYLPKARWGLRMGDSQVIDGMVHDGLSCSFHPDKVHMGTYGNSTAEDFDLSREEQDKW
SARSHERAIKAKDLFAEEIVAIDIPQRKGDPITVDVDESPRANSTIEALAKLKPAFGKDG
TITAGNAPGINDGAAALVLMSEERAQKEGKNVLAHVLSHTEVAIEPHRFPETPGIVINEL
LKKTGKSIDEIDLFEINEAFAAVALASSKIAGLDAEKVNVNGGSVALGHPIGASGARIIL
TLAYELKRRGGGIGIAAICSGGGQGDAIMIEVPKEAK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagtcattattgacggagcacgtacagcatttgggaaattcggaggaaac
ttaagcacattatcagccagtgaccttggagcagaagcgatcaaagctgcaatgagccgc
gcagatatccaactagatgatgttcaagaagtaatcatggggaacgttttacaagctggt
caaggacaaatcccatcccgccaagcggcaacaaaagcaggtattccatataacgttaaa
tctgaaacaatcaataaagtatgcgcatcgggcatgcgcagtgtcacgttagcagatcaa
attatccgtttaggcgatgaagaagtaatcgttgcaggcggtatggaatcgatgtccaac
gcaccttattatttaccaaaagcacgttggggtcttcgcatgggcgattcacaagtaatt
gatggcatggtccatgacggcttgtcttgttcattccacccagacaaagttcatatggga
acttacggcaactcaactgctgaagactttgacttgtctcgtgaagagcaagataaatgg
tcagctcgttcgcatgaacgtgcgatcaaagcaaaagatttgtttgctgaagaaatcgtg
gcaatcgacatcccgcaacgcaaaggagatccaattacagttgatgtggatgaatctccg
cgcgctaactcaacaattgaagcattggcaaaactaaaaccagcattcggaaaagacggt
acaatcactgccggaaatgcaccaggaattaatgacggtgcagcggcacttgtattaatg
agtgaagaacgcgcacaaaaagaaggtaaaaatgtattggctcatgttctttcacataca
gaagtggcaatcgaaccacaccgtttccctgaaacgccaggaattgtcattaacgaatta
ttaaagaaaacaggtaaatcaatcgatgaaattgatttattcgaaatcaacgaagctttt
gcagcagttgccttagctagttcgaaaattgcaggacttgatgctgaaaaagttaacgtg
aatggcggatctgtagcacttggccacccaattggggctagcggtgcacgcattatcttg
acactcgcttacgaattaaaacgtcgcggtggcggcattggtatcgcagcaatttgctca
ggtggcggacaaggcgacgcgatcatgattgaagttcctaaggaggcaaaataa

DBGET integrated database retrieval system