KEGG   Planococcus halocryophilus: BBI08_16145Help
Entry
BBI08_16145       CDS       T04473                                 

Definition
(GenBank) NADPH--cytochrome reductase
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
phc  Planococcus halocryophilus
Pathway
phc00071  Fatty acid degradation
phc00380  Tryptophan metabolism
phc00627  Aminobenzoate degradation
phc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:phc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBI08_16145
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BBI08_16145
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBI08_16145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:phc00199]
    BBI08_16145
Enzymes [BR:phc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BBI08_16145
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BBI08_16145
Cytochrome P450 [BR:phc00199]
 Cytochrome P450, bacteria type
  CYP102 family
   BBI08_16145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5 FMN_red
Motif
Other DBs
NCBI-ProteinID: ANU15289
UniProt: A0A1C7DUK8
Position
720562..723726
Genome map
AA seq 1054 aa AA seqDB search
MIEMKNLPQPKTYGPLGNLPLIDKEKPVQSFMKQARELGPIYQFHFPGRASTFVSSARLA
AEICDEIRFDKKIGPSLQKVRPFGGDGLFTSGTEEPNWKKAHNILLPSFSQQAMKGYHEK
MIDLSSQLVQKWARLNPNEEIDVPDDMTRLTLDTIGLCGFDYRFNSFYREDSHPFIEKMV
RALDESMSQTQRLGIQDKLMIRSKQQFKEDIDYMFNLVDQLIVERKQTGDQGEDDLLAHM
LKGKDPETGESLDDENIRFQIITFLIAGHETTSGLLSFAIYYLLKNPEKLQKAYQEVDNV
LGDDTPSFKQVKQLKYVRMILNEALRLWPTAPAFSVYAKEDTTLAGEYKVEKGDSFTLLI
PELHRDPSVWGEDAEAFIPERFEDISSIPHHAYKPFGNGQRACIGQQFALHEATLVLGMV
LQHFELEDYMDYELNVKETLTFKPDGLKMKVKSRRKVQMFQAPAVADKAESIAQSKPDAA
IESHGTPLLVLYGSNLGTAEGVARELAETARYQGFEVEAAPLDDYAGDLPTAGAVLIISA
SYNGNPPDNAIRFMDWLTTADKADLTGVTYAVFGCGDHNWATTYQRVPSIMDEQMAAIGA
SRLLARGEGDASEDFDGDLEKWQERLWPTLADHFDLDLEKREHSSSQVSMEFVSGISYTP
IARTYDAFTAVVAENIELLKAADRSTRHIEVQLPSGASYQEGDHLGVLPENSPTLVNRVL
NRFAIKGDEYVVLGESSGRASHLPTNQPVQLKQLVATYVEIQEPATRAQIRELASSNPCP
PHKMELEQLLEDEIYKREVLGKRQTMLELLEYYPSCELEFESFISLLPALKARYYSISSS
PRVAKQQASITVSLVRGEAWSGKGEYAGVTSNYLSSRQPGDKIACFIRTPQTDFQLPENP
ETPVIFVGPGTGIAPFRGFIQARRVLQVEGKTLGKAHLYFGCRHPEQDFLYEEELKEAEQ
LGLIELYSAFSRQHDEKIYVQHLMKNNAQAILSLLEQGGHLYICGDGSKMAPEVTDTLTQ
CYQELHQVSNQEAIAWLQGLEQSGRFAKDVWAAT
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatgaaaaaccttccacaaccaaaaacgtacggaccactcgggaatttgccg
ctcatcgataaagaaaagcctgtgcaatcgtttatgaagcaggctagagaactaggaccc
atctatcaatttcactttcctggacgtgccagcacatttgtatcaagtgcccggttagct
gccgaaatttgtgacgagatacgttttgacaaaaaaatcggaccctctcttcagaaagta
cggccatttggcggtgacggtttgttcacaagtggcacagaagaaccgaattggaaaaaa
gcccataatatcttgctaccaagtttcagccagcaggcgatgaagggataccatgaaaaa
atgattgaccttagttcgcagctagttcaaaaatgggcacggctgaatccaaatgaagaa
attgacgtaccggatgatatgacgcgtcttacattggatacgattggactgtgcgggttc
gactaccgcttcaacagcttttatcgtgaagattctcatccatttatcgaaaaaatggtc
agagcattggatgaatcgatgagccaaacgcaacgtttaggcatccaggacaagttgatg
attcgctcgaaacaacaatttaaagaagatattgattatatgttcaacttggtcgatcaa
ctgattgtagaacgtaaacaaacaggagaccaaggagaagatgatttgctggcacatatg
ttgaaagggaaagaccctgagaccggagagtctttggatgatgagaacatccggttccaa
atcattaccttcctgattgccggtcacgaaacaacaagcggcctactttcttttgctatc
tattatttgctgaaaaaccctgaaaaattgcaaaaagcttatcaagaagtagataacgtg
cttggtgacgatacgccttcttttaaacaagtaaagcagttaaaatacgtgcgaatgatt
ctgaacgaagctttgcggttatggccgactgcaccggcattttcagtatatgccaaagaa
gatacgacgcttgcgggcgagtacaaagttgaaaaaggagattcattcactttgttgatc
cctgaattgcatcgagacccttctgtttggggagaggatgcagaagcttttataccagag
cggtttgaagacatttcgagcatcccacatcacgcttataaacctttcggtaatggtcag
cgggcgtgtattggccaacagtttgcgcttcatgaagcgacgctagtccttggtatggtg
ctgcaacattttgagctggaagattatatggattatgaactaaatgtaaaagaaacctta
acgttcaagcctgatgggttaaaaatgaaagtgaaatctagaagaaaagtgcagatgttc
caagcaccagctgttgcagataaagcagaatcgattgcgcagtcgaagccggacgctgca
atcgaatcacatggtacacctttgctcgtgctgtacggatctaatctgggaacagcagaa
ggcgtagctcgcgagcttgcagaaactgcacgctaccaagggtttgaagtggaggctgct
ccattggatgactatgcaggagatctgccgactgcaggagctgtgctgattatctctgca
tcgtataacggaaatccaccggataatgcgattcgctttatggattggctgacaactgct
gacaaagcggatttgacgggtgtcacgtacgcggtctttgggtgcggagatcataattgg
gctaccacttatcaacgtgtcccgagcataatggatgaacagatggcagccattggtgct
tcaagactccttgctcgtggggaaggcgatgcgagtgaagacttcgatggcgacctcgaa
aaatggcaagagcgtttatggccgactctggcagatcactttgaccttgatcttgagaag
cgcgagcattcttccagtcaagtgtctatggaattcgtcagtggcatcagctatacgcca
attgcccgtacgtatgatgcgttcacagcagtagtggctgaaaacatcgaactattaaag
gcggctgaccgcagtacccgccatattgaagtccagttgccttcaggtgctagctaccag
gagggagatcatcttggggtgttgcctgaaaattctccaacattggtaaatcgcgtgttg
aatcgctttgctataaaaggtgacgagtacgtggttctgggtgaaagttcaggaagagcg
agtcatttgccaaccaaccagcctgttcagctcaagcaattagtagcaacttatgtggaa
atacaggaaccagccactcgcgctcaaattcgtgagctcgccagcagcaatccttgccca
ccgcataaaatggagctggaacaactcctagaagatgagatctataaacgggaagtgtta
ggcaaacgccagacaatgcttgaactattggaatactatccttcctgtgagctggaattt
gagagctttatttcattgttaccggcgttgaaagcccgttattattcgatttccagctca
ccgcgtgtagcgaaacaacaggcaagcattaccgtcagcttagtacgtggagaagcttgg
agcggcaaaggcgagtatgccggtgtcacttccaactacctatcatcacgtcagccaggt
gacaaaatcgcctgctttatccgaacgccgcaaacagatttccaactgcctgaaaatcct
gaaacaccagtgatttttgtcggacctggcacagggattgcgcctttcaggggctttatc
caggcacgccgtgtactgcaggtcgaagggaaaacattggggaaagcccatttgtacttt
ggttgccgtcatccggagcaggactttttatatgaagaagaactaaaagaagcagagcaa
cttggtttgattgaactttacagcgctttttcaagacagcatgacgaaaaaatctacgtc
cagcatttaatgaagaataatgcacaagccattctgtcgctattagaacagggcggtcac
ctgtatatttgtggagacggcagcaaaatggctcctgaagtgacggatacactgactcag
tgttatcaggaacttcaccaagtcagcaatcaggaagctattgcttggctgcaggggctt
gagcaatctggacgctttgcgaaggatgtctgggctgcgacttaa

DBGET integrated database retrieval system