KEGG   Pantholops hodgsonii (chiru): 102316504Help
Entry
102316504         CDS       T02909                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:phd00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102316504 (ABHD6)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102316504 (ABHD6)
Peptidases [BR:phd01002]
 Serine Peptidases
  Family S33
   102316504 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr FSH1 DUF1057 DLH Lipase BAAT_C Esterase UPF0227 Thioesterase
Motif
Other DBs
NCBI-GeneID: 102316504
NCBI-ProteinID: XP_005977902
Position
Un
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLALPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVRHGDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSMVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLVGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNKFVQRLKELQESAAVEKIPLIPTTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
TFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSITNSQVEL
LENCGHSVVMERPRKTAKLLVDFLASVHNTDNSKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgacgtggttaacatgtttgtgatcgcgggcgggacgctggctctgccgatc
ctggcattcgtagcctcatttctcctgtggccttcagccctgataagaatctattactgg
tactggcggaggacgctgggcatgcaggtccgctatgtgcgccacggagactatcagttc
tgctactccttccgcggcaggcctggccacaaaccttccatcctcatgctccacgggttc
tctgcccacaaggacatgtggctcagcatggtcaagttcctcccgaagaacctgcacctg
gtctgcgtggacatgccagggcatgagggcaccacccgctcctcactggatgacctgtcc
atagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaag
cccttccacctggtaggcacctccatgggcggccatgtggctggggtgtatgctgcttac
tacccgtcagatgtctgcagcctgtcccttgtgtgccctgctggtctgcagtactcaact
gataataaatttgtgcaacggctcaaagaactgcaggagtcggccgccgtggagaagatt
cccttgatcccgaccaccccggaggagatgagtgagatgctgcagctctgctcctacgtg
cgcttcaaggtgccccagcagatcctgcagggccttgtcgacgtccgcatccctcacaac
accttctaccgaaagttgtttttggaaatcgtcagtgagaagtcgagatactccctccat
cagaacatggacaagattaaggtccctacgcagataatctgggggaaacaagaccaggtg
ctcgatgtgtcgggggcagatatgttggccaagtcaatcaccaactcccaggtggagctc
ctggaaaactgtgggcactcggtggtgatggagaggcccaggaagacagccaagctcctt
gtcgacttcttagcttctgtacacaacacagacaacagcaagaagctggactga

DBGET integrated database retrieval system