KEGG   Pantholops hodgsonii (chiru): 102326997Help
Entry
102326997         CDS       T02909                                 

Gene name
PIK3C2G
Definition
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00562  Inositol phosphate metabolism
phd01100  Metabolic pathways
phd04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102326997 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102326997 (PIK3C2G)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     102326997 (PIK3C2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PX PI3K_C2 C2 PI3K_rbd DUF4135
Motif
Other DBs
NCBI-GeneID: 102326997
NCBI-ProteinID: XP_005980944
Position
Un
AA seq 1487 aa AA seqDB search
MAYYWKTDLNSSESHEKEQEHQEFSSLNQPLFPSTVSLGFDNVVDEISNKIPLCQREIEE
NAFFLPSAPHWDSRKHSLDETHQTSLNEFSFKSSELSCHQVSETPVIGFSRHSVLPNPQN
INKGSSWGNPIGKYHDADDYGFNILPLSSTSLDKTNSESQLENENRNYRIGFESSVLPIY
PSLSTNLMPKEENKSSRNMNIVESSLMPFKGSSLPRTWESRFPKNTELTGCSIQLVEVAQ
GSNTSLASFCNKVKKIRESYHAADMDSNSGKVWSTTTAFPYKLFSNTKLNINIFTDNSTK
GLHFIPCANYLVKDLIAEILHFCTNDQLFSRDHLLSICGHEEFLQNDHYLGSHRIFQKNK
SVLQLHLQKKRDTPGTLSRKHEDDHSQFYLNQLLEFMHIWKVSRQCLSTVIQKYDSDLKY
LLKTQQNVDNVIEEVKNICSVLGCVETKQITDAVNELNLILQRKPKNLHQNSDTSAKGLI
EKVTTELSTSICQLIDIHCSSFCADFQPLHAPLYSVSCVNLGLHSHLSFTVYAAHNIPET
WVHSYKAFSFSCWLTYAGKKLCQVRNCRNIPVKKLFFSLVNWNETINFPLEIKSLPRESM
LTIKLFGITYATNADLLAWTCFPLFPKHRSILGSVLFSMTLQSEPPMEMIAPGVWDVSQP
SPVTLQIDFPATEWEYMKLDSEENGSDLEEPPKECLKHIARLSQKQTPILLSEEKRRYLW
FYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWKFSHPLEALGLLTFSFPDQEIR
NVAVRQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLHRSLQSVQIAHRLYWLLKD
AQNEAYFKSWYQKLLAALQFCAGKALRDEFSKEQKLIKILGDIGEKVKTASDPQRQEVLK
KELGRLEEFFWCTKTCHLPLNPALCVQGIDGDACSYFTSNALPLKITFINANPMGKNISV
IFKAGDDLRQDMLVLQIIQVMDNIWLQEGLDMQMIIYRCLSTGKGQGLVQMVPDAVTLAK
IHRRFGPIGPLKENTIKKWFSQHNPLKADYEKVLRNFFYSCAGWCVVTFILGVCDRHNDN
IMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEYFITEGGKNPQHFQDFVEL
CCRAYNIVRRHSRLLLNLLEMMLHAGLPELSGIQDLKYVYNNLRPQDTDLEATSHFTKKI
KESLECFPVKLNNLIHTLAQMTAISPAKSTSQTFSQESCMPGASRSIQRATVLGFSKKTS
HLYLIQVTHSNNETSLTEKSFDQFAKLHSQLQKQFASLTLPEFPHWWHLPFTDSDHKRVR
DLNHYMEQILNGSYEVANSDCVLSFFLSEPVEQAVKESSAVDLGEKFADKKPKVQLVISY
KDAKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEARRRKTKSVPKCTDPTYNEIVVY
DEVTELQGHVLMLIVKSKTTFVGAINIQLCSVMLNEEKWYPLGNSII
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atggcatattactggaaaacagatctaaattccagtgaatcacatgaaaaggagcaggag
caccaagaattctcctccttgaatcaacctctttttcctagcacagtcagtctgggtttt
gataatgtagtagatgagatcagtaacaaaatcccactctgtcagagagaaattgaagaa
aatgccttttttctgcccagtgcaccacactgggactcaagaaaacattcattagatgaa
acacaccaaacatccttgaatgaattcagttttaaaagctcagaactctcctgtcaccaa
gttagtgaaacgccagtaattggttttagtaggcattctgtgctaccaaatcctcaaaac
atcaataaaggaagctcttggggaaatcccataggaaaatatcatgatgctgatgattac
ggattcaatattttgcctctatcatctaccagtctggataaaactaattcagagagtcaa
ctggaaaatgaaaatcgtaactaccgtataggatttgaaagcagcgttcttcctatatac
ccatccttgtcaactaacttgatgccaaaagaagaaaataaaagcagtagaaatatgaac
attgtagagtcttctctgatgccctttaaaggttcttctctacccaggacatgggaaagt
agattcccaaagaacacagagctgacaggttgttccattcagctggttgaagtagctcaa
ggcagtaatacgagtttggcatccttttgcaacaaagtaaaaaaaataagagaatcatat
catgccgctgacatggattccaattctgggaaggtctggagcacaactacagcatttcca
tataagctcttttctaatactaagcttaatataaatatttttactgataactcaacaaaa
ggacttcattttatcccatgtgctaattatcttgtcaaagacctaattgcagaaattcta
catttttgcacaaatgaccagttattctccagagatcatcttttaagtatatgtggccat
gaagaatttttacaaaatgatcactatttgggaagccacagaatatttcagaaaaataaa
tctgttcttcaacttcatctacagaaaaagagagacactccaggaacattatctcgaaag
catgaagatgaccacagtcagttttatctgaaccagcttctagaatttatgcatatctgg
aaagtatccagacagtgtctctcaacagtaatccaaaaatatgactccgacctgaaatac
ttattgaaaactcagcaaaatgtggataatgttattgaagaagtaaaaaatatatgcagt
gttctgggatgtgtggagaccaaacaaattacagatgctgtaaatgaactaaatcttatt
cttcagagaaagccaaagaatcttcatcaaaattcagacacttcagcaaaaggtttgata
gagaaagtgacaactgaactatccacatccatctgtcagctaattgatatccactgcagc
agcttctgtgcagatttccagcctctacatgcacctctgtatagtgtctcctgtgtaaat
cttgggctccattcccaccttagcttcacagtgtatgcagctcacaatattccagaaacc
tgggtgcacagctataaagcattttctttctcctgttggctgacatatgctggaaagaag
ctgtgccaagtgagaaactgcagaaatattcctgtcaaaaagttgttcttttccttggtc
aactggaatgaaacgatcaattttcctcttgaaataaaatcacttccaagggaatccatg
ctcactataaaattgtttgggattacctatgcaaccaatgcagatttattggcctggact
tgttttccactgtttccaaaacacagatccattcttgggtctgtgctattcagcatgaca
ttacaaagtgagcctcccatggaaatgattgctccaggagtgtgggatgtaagtcagcca
tccccagtgaccctgcagattgattttccagctactgagtgggagtatatgaagcttgat
tctgaagagaatggaagtgatcttgaagaaccaccaaaagaatgtttaaaacatattgcc
agactatcacagaaacagactccgatactcctctctgaggaaaagagaagatacttatgg
ttttatcgcttctactgcaacaatgaaaattgctcccttcctttggtcttgggaagtgcc
cctggatgggatgaaagaactgtttcagaaatgcataccattttaagaagatggaaattc
tctcaccctttggaggcacttggacttttgactttcagttttccagatcaagaaattcgt
aatgtggcagttcggcagttagacaacctcttgaatgatgaactactggaatatctccca
cagctagttcaggctgtcaagtttgaatggaaccttgagagtcctctagtgcaacttctg
ttacaccgctcgctacaaagcgtccagattgcccatcgtctttactggctgctaaaggat
gcacagaatgaagcttattttaaaagctggtatcagaagctattggctgcactccaattc
tgtgcaggaaaagccttgagggatgagttttccaaggagcagaaacttatcaagattctg
ggagacattggggaaaaagtcaagactgctagtgaccctcaaagacaggaggtcctgaag
aaggagcttggcagactagaagaattcttttggtgtacaaagacctgtcacctccctctg
aaccctgccttatgcgtacaggggattgatggtgatgcatgttcatatttcacatctaat
gctttgccgttgaagattactttcattaatgccaatccaatgggcaaaaacatcagtgtc
atttttaaggctggagatgatctccgtcaggatatgcttgttctgcagattattcaagtg
atggacaatatttggctgcaggagggcctggatatgcaaatgatcatttatagatgtcta
tccacgggaaaaggccaagggttggtgcagatggtgcctgatgctgtaaccctagcaaaa
atccatcgccgttttggaccgataggacccctgaaagaaaatacaatcaaaaaatggttc
agtcaacacaaccctttaaaggcggattatgaaaaggtcttaaggaacttcttctattcc
tgtgctggctggtgtgtggtgacattcatcctaggagtctgcgaccgacacaacgacaat
atcatgctgacaaagtcgggccacatgtttcatattgactttggaaaattcctgggtcat
gcacaaacatttggagggataaaaagagaccgagccccttttatttttacttcagagatg
gagtactttattacagagggtgggaaaaacccacagcattttcaagattttgtggagctt
tgctgtagagcttataatattgtcagaagacacagccggctgctcttgaacctgctagaa
atgatgttacatgcaggattgcccgagctaagtggaatccaagacctgaaatatgtgtat
aataatcttcgtccacaagatacagacctggaagcaacgagtcattttaccaagaaaata
aaggaaagtctggagtgcttccctgtgaaattgaataacttaatccacacacttgcacaa
atgacagccataagccctgccaaatcgacttcacagacgttttcccaggaatcctgtatg
ccaggtgcaagcaggtcaatccaaagagcaacagtcttagggttcagcaagaaaaccagc
catctgtatctaatccaggtgactcacagtaacaatgaaacaagcctgacggaaaagtca
tttgaccagtttgcaaaacttcacagccaacttcaaaagcagtttgcatcactgaccctc
ccagagtttcctcattggtggcacttaccttttacagattcagatcacaaaagagtcaga
gatctaaatcattacatggaacagatattaaatggatcgtatgaagttgcaaacagtgat
tgtgtacttagctttttcctctctgagcccgtggaacaagcagtgaaagaatcatcagct
gtggacctaggtgagaagtttgctgacaagaagcctaaagtgcagttagtcatatcctac
aaagacgcgaagctgaccatacttgtgaagcacatgaaaaacatccatctcccagatggc
tccgcgcccagtgcacatgttgaattttatcttttaccgtatcccagtgaagcccggagg
aggaaaacaaaatctgttccaaaatgtactgaccccacttacaatgagattgtagtatat
gatgaagtcacagagctccaaggacatgtcttaatgcttattgtaaagagcaaaaccaca
tttgtaggagcaattaacatccaactctgcagtgtcatgctcaatgaagaaaaatggtat
ccactaggtaacagtataatttga

DBGET integrated database retrieval system