KEGG   Pantholops hodgsonii (chiru): 102327246Help
Entry
102327246         CDS       T02909                                 

Gene name
CAMK1
Definition
(RefSeq) calcium/calmodulin dependent protein kinase I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04020  Calcium signaling pathway
phd04921  Oxytocin signaling pathway
phd04925  Aldosterone synthesis and secretion
phd05214  Glioma
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102327246 (CAMK1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102327246 (CAMK1)
   04925 Aldosterone synthesis and secretion
    102327246 (CAMK1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    102327246 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phd01001]
    102327246 (CAMK1)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102327246 (CAMK1)
Protein kinases [BR:phd01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   102327246 (CAMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Tyrosinase
Motif
Other DBs
NCBI-GeneID: 102327246
NCBI-ProteinID: XP_005984334
Position
Un
AA seq 370 aa AA seqDB search
MPGAVEGPSWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYRHDLGIVPRDLKPENLLYYSLDEDSKIMISDFGLSKVEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASRGELLAPAAGGPVAGCCCRDCCVEPSP
ELSPSLHPQL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgggggcagtggaaggccccagctggaagcaggcggaggacattagagacatttac
gacttccgagatgttctgggaacaggagccttctccgaggtcatcctggcagaagataag
aggactcagaagctggtagccatcaaatgtatcgccaaaaaggctctggagggcaaggag
ggcagcatggagaatgagatcgctgtcctacacaagatcaagcaccccaacattgtagcc
ctggatgacatctatgagagtgggggacacctctatctcatcatgcagctggtgtcaggc
ggtgagctgtttgaccgaattgtggaaaaaggcttctacacggaacgggatgccagccgc
ctcatcttccaggtgctggatgctgtcaagtaccgacacgacctgggcatcgtaccccga
gacctcaagccagagaatctgctgtactacagcctggatgaagactctaagatcatgatc
tccgactttggcctctccaaggtggaagaccccggcagtgtgctctccacggcctgtggg
accccaggatacgtggcccctgaggtgctggcccagaagccctacagcaaggccgtggat
tgctggtccatcggggtcatcgcctatatcctgctctgtggttatcctcccttctatgac
gagaatgatgccaaactctttgaacagattttgaaggccgagtacgagtttgactctcct
tactgggacgacatctctgactctgccaaagacttcatccggcacttgatggagaaggat
ccagagaagaggttcacctgtgagcaggccttgcagcacccctggattgcaggagatact
gccctagataagaatattcaccagtccgtgagcgagcagatcaagaagaactttgccaaa
agcaagtggaagcaagccttcaatgccacagccgtggtgcggcacatgaggaagctacag
ctgggcaccagccaggaggggcagggacagacagcgagtcgtggggagctcctggcacca
gcagccggggggccggtggctggctgctgctgtcgtgactgctgtgtggagcccagccca
gaactgtccccctctctgcaccctcagctctag

DBGET integrated database retrieval system