KEGG   Pantholops hodgsonii (chiru): 102329276Help
Entry
102329276         CDS       T02909                                 

Gene name
SI
Definition
(RefSeq) sucrase-isomaltase (alpha-glucosidase)
  KO
K01203  sucrase-isomaltase [EC:3.2.1.48 3.2.1.10]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00052  Galactose metabolism
phd00500  Starch and sucrose metabolism
phd01100  Metabolic pathways
phd04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102329276 (SI)
   00500 Starch and sucrose metabolism
    102329276 (SI)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102329276 (SI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phd04147]
    102329276 (SI)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     102329276 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     102329276 (SI)
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102329276 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102329276
NCBI-ProteinID: XP_005984867
Position
Un
AA seq 1813 aa AA seqDB search
MAKKKFSGLEITLIVLFAIVTIIAVALVVVLATKTPAFEEISDSTRGTCPSVLNDPINQR
INCIPERSPTQTLCAARGCCWRPWNDSVIPWCFFVNNHGYNAEKVTSTNAGLEAKLKRKA
SPTLFGNDISSVLLTTQNQTRNRVRFKITDPNNRRYEVPHQFVKEFSGTAASDPLYNLEV
IHDPFSIKISRKSNNKILFDTSIGPLVYSDQYLQISARLPNEYIYGLGEHIHKRFRHDLY
WKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSNAMEIFIQPTPIVTY
RVIGGILDFYIFLGDTPEQVVQQYQELIGQPAMPAYWNLGFQLSRWNYKTLDVVKEVVKR
NREAGIPFDTQITDIDYMEDKKIFTYDQVAFNGLPEFVQDLHDHGQKYVIILDPAVSIDK
RVNGAAYESYDRGTAQKVWVNESDGTTAIIGEVWPGLTVYPDFTNPSCIEWWANECYLFH
QQVNYDGLWIDMNEVSSFVQGSKKGCSANNLNYPPFTPDILDKLMYSKTICMDAMQYWGK
QYDVHSLYGYSMSIATEKAIEKVLPNKRSFILTRSTFAGSGSHSAHWLGDNTASWEQMEW
SITGMLEFGLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPYARNHNADGYQHQDPAF
FGQDSLLVKSSKHYLNIRYALLPFLYTLFYKAHMFGETVARPFLHEFYEDTNSWIEDTQF
LWGPSLLITPVLKQGAEIVSAYIPDATWYDFETGVKRPWRKQRVDMQLPGDKIGLHLRGG
YIIPFQEPAVTTTASRKNPLGLIVALNDNNTAKGDFFWDDGETKDTIQKGNYILYTFSVS
NNKLDITCMHSSYPEGTALAFETIKVLGLTDTVTEVSVIEDNQPLRAHYNFSYDASNQIL
LIYNLTFNLGGNFTVQWDQTFLEVEKFTCYPDSDTATKERCEERGCLWQTAQLGSKAPEC
YFPKEDNSYLVHSTQYSSVGITADLQLNTANPRIKLPSDSISSLRVEVKYHKDDMLQFKI
YDAQNKRYEVPVPLNIPTTPTSTYETRLYDVEIKENPFGIQIRRRSTRRVIWDSRLPGFA
FNNQFIQISTRLPSEYVYGFGEMEHTTFRHDLNWRTWGMFTRDQPPGYKLNSYGFHPYYM
ALEDENNAHAVLLLNSNAMDVTFQPMPALTYRMIGGILDFYMFLGPSPEVATKQYHEVIG
QPVMPPYWALGFQLCRYGYRNTSQVEEVYNDMVAARIPYDVQYTDIDYMERQLDFTIDDE
FRDLPQFVDKIRSEGMRYIIILDPAISGNETKPYPAFERGQEKDVFVKWPNTNDICWAKV
WPDLPNVTIDESLTEDEAVNAFRAHAAFPDFFRNSTAEWWAREIIDFYNNQMKFDGLWID
MNEPSSFVNGTTSNQCRNTELNYPPYFPELTKRTDGLHFRTMCMETEQILSDGSSVLHYD
VHNLYGWSQLKPTYDALQKATGKRGIIISRSTYPSAGRWSGHWLGDNYATWDNLEKSIIG
MMEFSLFGMSYTGADICGFFNNSEYQLCARWMQLGAFYPYARNHNSAFTRRQDPASWNKT
FSTMSRDILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFLNEKPTWDIFKQFLWGPAF
MVTPVLEPYVDTVEGYVPNARWFDYHTGKDIGVRETFHTFAAPLYEINLHVRGGYILPCQ
EPANNTFYSRQNYMKLIVAADDNQMAQGSLFWDDGETIDTYEKDLYSLVQFNLNKTILTS
TILKNGYINRSEMRLGYIHIWGKEKMRVSEVILTHNGNKESVNFTEDPNLEILNIDLRGN
NVTLDEPIKVNWS
NT seq 5442 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaagaaattttctggattagaaattactctgattgtcctctttgctatagtt
acaataatagctgttgcccttgttgttgttttagcaactaagacacctgcttttgaagaa
atcagtgattcaacccgaggcacatgcccaagtgtattgaacgatcctatcaaccagaga
ataaactgcattccagaacgatctcccacacagacactttgtgcagctcgaggttgctgc
tggaggccatggaatgattctgttattccttggtgcttcttcgtaaataaccacggctat
aatgctgagaaagtaacatcaacaaatgctggacttgaagccaaattaaaaaggaaagct
tcacctacactctttggaaatgacattagcagcgttctcctcacaactcaaaatcagaca
cgcaatcgtgtgcggttcaagatcactgatccaaataatagaagatatgaagttcctcat
cagtttgtaaaagaatttagtggaactgcagcttctgatccactatataatctggaggtt
atacatgatccatttagcattaaaatttctagaaaaagcaataataaaattttgtttgat
accagcattggtcccctggtatactctgaccagtatttacagatctcagccagacttccc
aatgaatacatttatggtctcggggaacatattcataagagatttcgtcatgatttatat
tggaaaacatggccaatttttactcgggatcaacttcctggtgataataataataattta
tatggccatcaaacattcttcatgtgcattgaggatacttccggaaagtcatttggtgtt
ttcttaatgaacagcaatgcaatggagattttcatccaacctactccaatagtaacttac
cgagttataggtggaattctggacttttatatctttctgggagacacaccagaacaagta
gttcaacagtatcaggagctcattggacaaccagcaatgccagcttattggaatcttgga
ttccagctgagtcgctggaattacaagacacttgatgtagtgaaagaagtggtaaaaaga
aatcgggaagctggcataccatttgacacacaaatcaccgatattgactatatggaagac
aagaaaatctttacttatgatcaagttgcatttaatggcctcccagaatttgttcaagat
ttgcatgaccatgggcagaaatatgtcatcatcttggaccctgcagtttccatagataaa
cgtgtgaatggagcagcatatgagtcctatgataggggaactgcccaaaaggtgtgggtg
aatgagtcagatgggactacagcaattattggagaggtatggccaggattaacagtatac
cctgatttcacaaatccaagttgcatagaatggtgggcaaatgaatgctacctttttcat
caacaagtaaattatgatggactttggattgacatgaatgaagtttccagctttgttcaa
ggttcaaagaaaggatgcagtgcgaacaacctgaattatccaccttttactcctgatatt
cttgacaaactcatgtattccaaaacaatttgcatggatgccatgcaatactggggaaaa
cagtatgatgtacacagcctctatggatatagtatgtctatagccacagagaaagctata
gaaaaagttcttcctaataaaaggagctttattctcacccgatcgacttttgctggatct
ggaagccattctgcacattggttaggagacaatactgcttcttgggaacaaatggaatgg
tctattacaggaatgctggagtttggtttgtttggaatacctttggttggagcagatatc
tgtgggtttgtggctgagaccacagaagagctttgcagaaggtggatgcaacttggagct
ttttatccatatgccagaaaccataacgctgatggatatcagcatcaggatccagcattt
tttggacaggattctcttttggttaagtcatcaaaacactatttgaatattcgctatgcc
ttgttacctttcctttatactctattttataaagcccatatgtttggagaaacagtagca
aggccttttcttcatgagttttatgaggatactaatagctggattgaggatactcagttc
ttatggggcccctcattacttataacccctgtattgaaacagggtgcagaaatagtgagt
gcatacatccctgatgctacttggtatgactttgaaactggtgtaaaaaggccatggaga
aaacaacgtgttgatatgcagcttccaggagacaaaataggattacatcttagaggtggt
tacattatcccctttcaagaacctgctgtaactacaacagcaagccgaaagaaccctcta
ggacttatagttgcattaaatgataataacacagcaaaaggagactttttctgggatgat
ggagaaactaaagataccatccaaaagggaaactacattttatatacattttcagtttct
aataacaagctagatatcacatgtatgcattcatcatacccagaaggaactgctttagca
tttgagaccataaaagtcctcggattgacagacactgttacagaagtttcagtgatagaa
gacaatcaaccactgagagctcactacaatttcagttatgatgcttccaaccagattcta
ctaatttacaatctgacatttaaccttggaggaaactttactgttcaatgggatcaaact
ttcttggaagttgaaaagtttacttgttatccagattcagacacggcaactaaagaacgc
tgtgaagaacgtggctgcttatggcaaacggctcagttaggatccaaagcacctgagtgt
tactttcctaaagaagacaactcttatttagtccactcaactcagtactcatcagtgggt
ataacagctgacctccagctgaatactgcaaatcctcgaataaagctaccttctgattcc
atctcatctcttcgtgtggaggtgaaatatcacaaagatgatatgttgcagtttaagatt
tatgatgcccaaaataagagatatgaagttccagtaccattgaacattccaactacacca
acaagtacttatgaaactagactttatgatgttgaaatcaaggaaaatcctttcggcatt
cagattcgaagaagaagcacaagaagagttatttgggattctcgccttcctggttttgct
tttaacaaccagttcattcagatatctacacgcctgccttcagaatatgtgtatggtttt
ggggaaatggaacacacaacatttaggcatgacctgaactggcgtacttggggaatgttc
accagagaccaaccccctggttacaaacttaattcctatggatttcatccctattacatg
gctctggaagatgagaacaatgctcatgcagttctcttacttaacagcaatgcaatggat
gttacatttcagccaatgcctgctctgacatatcgcatgattggaggaatcttggacttt
tatatgtttttgggcccatctccagaagtcgcaacaaagcaataccatgaagtaatcggc
caaccagtcatgccaccttactgggctttgggattccagttatgtcgttatgggtacaga
aatacttcacaagttgaagaagtatataatgacatggtggctgctcggatcccctatgat
gttcagtacacagatattgattacatggaaaggcaattagactttacaattgatgatgaa
ttccgtgaccttcctcagtttgttgacaaaataagaagtgagggaatgagatacattatt
atcctggatccagcaatttcaggaaatgaaacgaagccttaccctgcctttgaaagagga
caggagaaagatgtctttgtcaaatggcctaacacaaatgatatttgttgggcaaaggtt
tggccagatttgcctaatgtgacaatagatgaaagtttaactgaagatgaagctgttaat
gctttcagagctcatgcagcttttccagatttcttcaggaattctacagcagagtggtgg
gcaagggaaattatagatttttataataaccagatgaagtttgatggattgtggattgat
atgaatgaaccatcaagttttgtaaatggaacaactagtaatcaatgcagaaatacagag
ctaaattatccaccttatttcccagaactcacaaaaagaactgatggattacatttcaga
accatgtgtatggaaacagagcagattcttagtgatggatcatctgttttgcattatgat
gttcacaatctatatggatggtcacagctgaaacctacttatgatgcattgcaaaaggca
actggcaaaagaggaattattatttctcgttctacatatccttctgctggacgatggtca
ggacactggcttggagacaactatgcaacatgggacaatttggaaaaatctatcattggt
atgatggaatttagtctctttggaatgtcatatactggagcagatatctgtggtttcttc
aacaattcagaatatcagctctgtgctcgctggatgcaacttggagcattttatccatat
gcaagaaatcacaacagtgcatttactagaagacaagatcctgcttcctggaataaaact
ttttctacaatgtcaagggacattctaaatattagatacactttattgccttacttctat
acacagatgcatgaaattcatgctcatggtggcactgttatccgaccccttttgcatgag
tttttaaatgaaaagccaacctgggatatattcaaacagtttctgtggggtccagcattt
atggttacccctgtattggaaccttacgttgacactgtagaaggctatgtccctaatgct
cggtggtttgattaccatacaggcaaagatattggtgtcagagaaacatttcatacgttt
gcagctcctttatatgaaatcaacctacatgtccgtggtggttacatcctaccatgtcaa
gagcctgctaacaacacattttacagccggcagaattacatgaagctcattgttgctgca
gatgataatcagatggcacaaggatctctgttttgggatgatggagagactattgacacc
tatgaaaaagacctatattccttggtacaatttaatttaaataagaccatcttgacaagc
actatactgaaaaatggttacataaacagaagtgaaatgaggcttggatatatccacata
tgggggaaagaaaagatgcgtgttagtgaggttattctcacacataacggaaataaagag
tctgttaattttactgaagacccaaacctggagatattaaatattgatctaagagggaat
aatgttactctagatgaaccaataaaagtcaactggtcatga

DBGET integrated database retrieval system