KEGG   Pantholops hodgsonii (chiru): 102329470Help
Entry
102329470         CDS       T02909                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00561  Glycerolipid metabolism
phd01100  Metabolic pathways
phd04714  Thermogenesis
phd04723  Retrograde endocannabinoid signaling
phd04923  Regulation of lipolysis in adipocytes
Module
phd_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102329470 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102329470 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102329470 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102329470 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:phd01002]
    102329470 (MGLL)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102329470 (MGLL)
Peptidases [BR:phd01002]
 Serine Peptidases
  Family S33
   102329470 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_5 Thioesterase PGAP1 BAAT_C DUF1057 DUF1350
Motif
Other DBs
NCBI-GeneID: 102329470
NCBI-ProteinID: XP_005979499
Position
Un
AA seq 384 aa AA seqDB search
MPEESSPRLTPQNVPYRDLPHLVNADGQHLFCRYWKPSGTPRALVFVSHGAGEHCGRYEE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDALQHVDAVQKDHPGLPVFLLG
HSMGGAICILTAAERPGHFSGMVLISPLGVASPDSAALFKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNSDPLVCRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSRGAYLLMESAKSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAGAGFS
DMAETHTHTPHRLEGSLAQLTQTVLSPVRLSTTGSALNGGRFMQKLELMALSREPHNRPL
LRLMRKRVTMAGRFQSRMPGRHVV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaaagttcccccaggctgaccccacagaacgttccctaccgggacctccct
cacctggtcaacgctgacggacagcacctcttctgccggtactggaaaccctcaggcacg
cccagggcgctggtgtttgtgtcccacggggccggcgagcactgcggccgctacgaggag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccacgtcggccat
gggcagagtgaaggcgagaggatggtggtgtccgacttccatgtcttcatccgggacgcg
ctgcagcatgtggacgccgtgcagaaggaccacccggggctgcctgtcttccttctgggc
cactccatgggcggcgcaatctgcatcctcacagccgcggagcggccgggccacttctcg
ggcatggtcctcatctccccgctgggcgtcgccagcccagactcggcggcacttttcaag
gtctttgctgcgaaagttctgaacctcgtcctgccaaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacagaggtggacatctacaactcggaccccttggtc
tgccgggctgggctcaaagtctgcttcggcatccagctgctcaacgcggtgtctcgggtg
gagcgggcgctgcccaagctgacgctgcctttcctgctgctccagggctccgccgaccgc
ctctgcgacagcaggggtgcctacctgctcatggagtcggccaagagccaggacaagact
ctcaagatttacgaaggtgcctaccacatcctccacaaagagcttcctgaggtgaccagc
tccgtcttccgggagataaacacgtgggtctcgcaaaggacagcaggggctggcttctca
gacatggctgagacacacacacacacaccccacagattggagggatccctagcacagctg
actcagacagtcttgtcacctgtcaggctgtccaccactggatctgccttaaacggtgga
cgctttatgcaaaaactggagctcatggcactttccagagaaccccacaaccggccactg
ctgcgcctcatgcggaaacgtgtcaccatggcgggccgcttccaaagccgaatgccgggc
aggcacgtggtctga

DBGET integrated database retrieval system