KEGG   Pantholops hodgsonii (chiru): 102331981Help
Entry
102331981         CDS       T02909                                 

Gene name
BMPR2
Definition
(RefSeq) bone morphogenetic protein receptor type 2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04060  Cytokine-cytokine receptor interaction
phd04350  TGF-beta signaling pathway
phd04360  Axon guidance
phd04390  Hippo signaling pathway
phd04550  Signaling pathways regulating pluripotency of stem cells
phd05206  MicroRNAs in cancer
phd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102331981 (BMPR2)
   04390 Hippo signaling pathway
    102331981 (BMPR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102331981 (BMPR2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102331981 (BMPR2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102331981 (BMPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102331981 (BMPR2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102331981 (BMPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phd01001]
    102331981 (BMPR2)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102331981 (BMPR2)
Protein kinases [BR:phd01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102331981 (BMPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Cadherin_C_2 FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102331981
NCBI-ProteinID: XP_005980260
Position
Un
AA seq 1038 aa AA seqDB search
MTSSPRRPRRVPSLLWTVLLVSAAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMKLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEVPYPDETSLHATNVSQPVGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSN
LKQVETGVAKMNTINAAEPHIVTVTMNGVAGRNHSVNSHTATTQYANGIVPSGQTANTVA
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQEVLTQGVPSTVADPGPSKPRRAQRPNSLDLSATNVLDGSSLQLGDST
QDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGKDRAVHSKSSTTVYLA
DGGTATTMVSKDIGMNCL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgtcgccgcggcggccccggcgggtgccctcgctgctgtggaccgtcctgctg
gtcagcgctgcggccgcttctcagaatcaagaacgtctctgtgcatttaaagatccatat
caacaagaccttgggataggtgaaagtagaatctctcatgaaaatggaacaatattatgc
tcaaaaggtagcacctgctatggcctttgggagaaatcaaaaggggacatcaatctggta
aaacaaggatgttggtctcacattggtgatccccaggagtgtcactatgaagaatgtgta
gtaactaccaccccaccctcaattcagaatggaacataccggttctgctgctgtagcaca
gacttgtgtaatgtcaactttactgagaattttccacctccagacacaacaccactcagt
ccacctcattcatttaaccgagatgagacaataatcattgcattggcatcagtctctgta
ttagctgttttgatagttgccttatgctttggatataggatgctgacaggcgaccgcaaa
caaggtcttcacagtatgaatatgatggaggcagcagcgtcagagccctctcttgaccta
gataatctgaaactgctggagctgattggccggggtcgatatggagctgtatataaaggt
tccttagatgaacgtccagttgccgtaaaagtgttttcctttgcaaaccgtcagaatttt
atcaatgagaagaacatttacagagtgcctttgatggaacatgacaacattgctcgcttt
atagttggagatgagagagtcactgcagatggacgcatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaagtatttaagtctccatacaagtgactgggtaagc
tcttgccgtctggctcattctgtgactagaggattggcttatcttcatactgaattacca
cggggagatcattataaacctgcaatttcccatcgagatttgaacagcagaaatgttctg
gtgaaaaatgatggaacctgtgttattagtgactttgggttgtccatgaagctgactgga
aatagactggtgcgcccaggggaggaagataatgcagccattagtgaggttggcacaatc
agatacatggcaccagaagttctggaaggagctgtgaaccttagggactgtgaatcagct
ttgaagcaagtagatatgtatgcacttggactaatttattgggagatatttatgagatgt
acagacctctttccaggtgaatctgtaccagaataccagatggcttttcagacagaggtt
ggaaatcatcccacttttgaagatatgcaggttctggtgtctagggaaaaacagagaccc
aagttcccagaagcttggaaagaaaatagcctggcagtgagatcactcaaggagacaatc
gaagactgttgggaccaggatgcagaggctcggcttactgcgcagtgtgctgaagagagg
atggctgaacttatgatgatatgggaaagaaacaagtctgtgagcccaacagtcaatcca
atgtctactgctatgcagaatgagcgcaacctgtcacacaataggcgtgtgccaaagatt
ggtccttatccagattattcttcttcctcatacattgaagattctatccatcacactgac
agcattgtgaagaacatttcctctgagcattcgatgtccagcacacctttgactataggg
gaaaagaaccgaaactcaattaactatgaacggcagcaagcacaagctcgaatccccagc
cctgaaacaagcgtcaccagcttgtctaccaacaccacaaccacaaacaccactggcctc
actccaagtaccggcatgaccactatatctgaggtgccatacccagatgaaacaagtctg
catgccaccaatgtttcacagccagttgggccaacccctgtctgcttacaactgaccgaa
gaagacttggagaccaacaagctggacccaaaagaagtcgataaaaacctcaaggaaagt
tctgatgagaatctcatggagcattctcttaaacaattcagtgggccagacccactgagc
agtaccagttctagcttgctttacccacttataaagcttgcagttgaagtgactgggcag
caggacttcacacaggctgcaaatggccaagcatgtttgattcctgatgtcccacccact
cagatctatcctctccccaagcaacagaaccttcctaagagacctactagtttgccttta
aacaccaaaaattcgacaaaggagcccaggctgaaatttggcagcaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgctgcagaacctcat
atagtgacagtcactatgaatggtgtggcaggtagaaaccacagcgttaattcccatact
gccactactcagtatgccaatgggatagtaccatctggccagacagccaacacagtggca
cacagagcccaagaaatgctgcagaatcaattcattggtgaggacactcggctgaacatt
aattccagtcctgatgaacatgaacctttactgagacgagagcagcaggctggccatgat
gaaggtgttctggatcgtcttgtggacaggagagaacggcccctagaaggcgggcgaact
aattccaacaacaacaacagcaatccatgttctgagcaagaagttctcacacagggtgtt
ccaagcacagtagcagaccccggaccatcaaagcctagaagagcacagaggcctaattct
ctggatctttcagccaccaatgtccttgatggcagcagtttgcagttaggtgactcaaca
caagatggcaaatcaggatctggtgaaaagatcaagaaacgagtgaaaactccctattct
ctaaagcggtggcgcccctccacctgggtcatttccactgaaccactggactgtgaggtc
aacaacaatggcaaagacagggcagtgcattccaaatccagcaccactgtttaccttgca
gacggaggcaccgccacgacgatggtgtctaaagatatagggatgaactgtctgtga

DBGET integrated database retrieval system