KEGG   Pantholops hodgsonii (chiru): 102338873Help
Entry
102338873         CDS       T02909                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00010  Glycolysis / Gluconeogenesis
phd00562  Inositol phosphate metabolism
phd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102338873 (MINPP1)
   00562 Inositol phosphate metabolism
    102338873 (MINPP1)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102338873 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102338873 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 102338873
NCBI-ProteinID: XP_005982311
Position
Un
AA seq 462 aa AA seqDB search
MHRGPCSLVRVSATPVAALAVALLSSLSRCSLLEPENSVVSALSPYFGTKTRYEDVNPGL
LPDPEAPRRDPELLEETCTPVQLVALIRHGTRYPTTKQIRKLRQLHRQDWPLWYADWMDG
QLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLVTSSKHRCVDSGAAFLQGLWQHYHP
GLPPPDVADMECGPPRINDKLMRFFDHCEKFLTQVERNATALHHVEAFKTGPEMQSILKK
AADILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWK
RGYGYTINSRSSCTLFQDIFQHLDKAVKQKQCSQPVSSPVILQFGHAETLLPLLSLMGYF
KDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLYHCKNAKTPKEEFRVQLLLNEKVLP
LAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKVNTSDEL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcccgtgcagcctcgtcagggtctccgcaacgcccgtcgcggccctggct
gtggcgttgctctcgtcgctctctcgctgctccctcctggagccggagaacagtgtggtc
tccgcgctcagcccctacttcggcaccaagactcgctatgaggatgtcaaccccgggctg
ctgccggaccctgaagcgccgcggcgggacccggagttgttagaggagacctgcaccccg
gtgcaactggtcgccctcatccgccatggcacccgctacccgacgaccaaacagatccgc
aagctgcggcagctgcaccggcaggactggccgctatggtacgctgactggatggacggg
cagctggtggagaaggggcggcaggacatgcgacagctggccctgcgcctggcctccctt
ttcccagccctcttcagcagagagaactacggccgcctgcagctagtcaccagctccaag
caccgctgcgtggacagcggcgccgccttcctgcaagggctctggcagcactaccacccg
gggttaccgccacccgacgtcgcagatatggagtgtggacctccaagaattaacgataaa
ctgatgaggttcttcgaccattgtgagaagttcttgactcaagtggagaggaatgctact
gctcttcatcatgtagaagccttcaaaactggaccagaaatgcagagcattttaaaaaaa
gcggcagacattttgcaagtgccagtcaacaacttaaatgcagatttaattcaggtagcg
tttttcacctgttcctttgacctggcaattaaaggtgttaaatctccttggtgtgatgtt
tttgacatagatgatgcaaaggttttagaatatttaaatgatctgaaacaatattggaaa
agaggatatggatatactattaacagtcgatccagctgcaccctgtttcaggatatcttt
cagcacttggacaaagcagttaaacagaaacaatgttctcaaccagtttcctctccagtc
atcctccagtttggccatgcagagacccttcttccactgctttctctcatgggctacttc
aaagacaaggaacctctaacagcttacaattacaaggagcaaatgcatcggaagttccga
agtggtcacattgtaccctatgcttcaaacctgatatttgtgctttaccattgtaaaaat
gctaagactcctaaagaagaattccgagtgcagttgttactgaatgaaaaagtgttacca
ctggctcactcacaagaaactgtttctttgtatgaagatctgaagaaccactataaggac
atccttcagagttgtcataccagtgaagaatgtgaactaccaaaggtgaacacatctgat
gagctatga

DBGET integrated database retrieval system