KEGG   Pantholops hodgsonii (chiru): 102344118Help
Entry
102344118         CDS       T02909                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04010  MAPK signaling pathway
phd04014  Ras signaling pathway
phd04015  Rap1 signaling pathway
phd04022  cGMP-PKG signaling pathway
phd04066  HIF-1 signaling pathway
phd04068  FoxO signaling pathway
phd04072  Phospholipase D signaling pathway
phd04150  mTOR signaling pathway
phd04151  PI3K-Akt signaling pathway
phd04152  AMPK signaling pathway
phd04211  Longevity regulating pathway
phd04213  Longevity regulating pathway - multiple species
phd04520  Adherens junction
phd04910  Insulin signaling pathway
phd04913  Ovarian steroidogenesis
phd04923  Regulation of lipolysis in adipocytes
phd04930  Type II diabetes mellitus
phd04931  Insulin resistance
phd04932  Non-alcoholic fatty liver disease (NAFLD)
phd04960  Aldosterone-regulated sodium reabsorption
Module
phd_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102344118 (INSR)
   04015 Rap1 signaling pathway
    102344118 (INSR)
   04010 MAPK signaling pathway
    102344118 (INSR)
   04066 HIF-1 signaling pathway
    102344118 (INSR)
   04068 FoxO signaling pathway
    102344118 (INSR)
   04072 Phospholipase D signaling pathway
    102344118 (INSR)
   04022 cGMP - PKG signaling pathway
    102344118 (INSR)
   04151 PI3K-Akt signaling pathway
    102344118 (INSR)
   04152 AMPK signaling pathway
    102344118 (INSR)
   04150 mTOR signaling pathway
    102344118 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102344118 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102344118 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102344118 (INSR)
   04913 Ovarian Steroidogenesis
    102344118 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102344118 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102344118 (INSR)
   04213 Longevity regulating pathway - multiple species
    102344118 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102344118 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102344118 (INSR)
   04931 Insulin resistance
    102344118 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phd01001]
    102344118 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:phd04090]
    102344118 (INSR)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102344118 (INSR)
Protein kinases [BR:phd01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102344118 (INSR)
CD molecules [BR:phd04090]
 Proteins
  102344118 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 102344118
NCBI-ProteinID: XP_005970345
Position
Un
AA seq 1345 aa AA seqDB search
MDIRNNLTRLHELANCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLE
SLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLAT
IDWSRILDSVEDNYIVLNKDDNEECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQK
VCPTICKSHGCTSEGLCCHSECLGNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQD
WRCVNFSFCQDLHNKCKNSRRQGCHQYVIHNNKCVPECPSGYTMNSSNLMCTPCLGPCPK
VCHLLEGEKTIDSVTSAQELRGCTIINGSLIINIRGGNNLAAELEANLGLIEEISGYLKI
RRSYALVSLSFFRKLRLIRGETLEIGNYSFYALDNQNLRQLWDWGKHNLTITQGKLFFHY
NPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSYDKILLKWE
PYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPTRSNDPKSQNHPG
WLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQ
IILKWKPPSDPNGNITHYLVFWERQAEDSELYELDYCLKGLKLPSRTWSPPFESEGSQKH
NQSEYEESAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFIPRKSSSGPVAEDARP
SRKRRALGDVGNVTAAVPTVLGFPNSSSTSTPMSSEEHRPFEKVVNKESLVISGLRHFTG
YRIELQACNQDSPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEP
NGLIVLYEVSYRRYGEEELHLCVSRRHYALERGCRLRGLLPGNYSVRVRATSLAGNGSWT
EATYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSICLFLRKRQPDGPLGPLYASSNP
EYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRS
LRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGD
FGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPY
QGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPKMRPTFLEIVDLLKDDLHPS
FPEVSFFHSEENKAPESEELEMEFEDMESVPLDRSSHAQREEAGGRDGGSALGLKRIYDE
HIPYAHMNGGKKNGRILTLPRSNPS
NT seq 4038 nt NT seq  +upstreamnt  +downstreamnt
atggatatccggaataatctcacccggctgcatgagctggccaattgctcggtcattgaa
ggacatttgcagattctgctgatgttcaaaacgagacctgaggacttcagagacctcagt
ttccccaaactcatcatgatcactgattacttgctgctcttccgggtctatgggctggag
agcctgaaggacttgttccccaacctcacggtcatccgaggctcgcgcctcttctttaat
tatgcactggtcatctttgagatggttcacctgaaggagcttggcctctacaacctgatg
aacatcacccgggggtctgtccgcattgagaagaacaatgaactctgctacctggccacc
atcgactggtctcgcatcctggattccgtggaggataattacatcgtgctgaacaaagac
gacaatgaggagtgtggggacatttgtccaggcaccgccaagggcaagaccaactgccct
gccactgtcatcaacgggcaatttgtggagcggtgctggacacacagccactgccagaaa
gtgtgtccgactatctgtaagtcacatggctgcacttctgagggtctctgctgccacagc
gagtgcttgggcaactgctcagagcccgacgaccccaccaagtgcgtggcctgtcgcaac
ttctacctggacggcaggtgcgtggagacctgcccacccccttactaccacttccaagac
tggcgctgcgtgaacttcagcttctgccaggacctgcacaacaaatgcaagaactctcgg
aggcaaggctgccaccagtatgtcattcacaataacaagtgcgtccccgagtgcccctct
ggctacacgatgaattctagcaacttgatgtgtaccccttgcctgggcccctgtcccaag
gtatgccacctcctggaaggtgagaagaccatcgattcagtgacatctgcccaggagctc
cgaggctgcaccatcatcaacggaagcttaatcatcaacattcgagggggcaacaacctg
gcagctgagctagaggccaaccttggactcattgaagaaatttcaggatatctgaaaatc
cgccggtcctatgccctggtgtcactttccttcttccggaagttacgtctgattcgaggg
gagaccttggaaattgggaactactctttctacgccttggacaaccagaacctaaggcag
ctatgggactggggcaaacacaacctcaccatcactcaggggaaactcttcttccactat
aaccccaaactgtgcctgtcggaaattcacaagatggaggaagtttcaggaaccaagggg
cgccaggagagaaatgacattgctctaaagaccaatggggaccaggcatcctgtgaaaat
gaattacttaaattttcttacattcggacatcttatgacaagatcttgctgaaatgggag
ccgtattggcctcctgacttccgagacctcctggggttcatgttgttctacaaagaggcc
ccttaccagaatgtgacagaattcgatgggcaggatgcatgcggctctaacagctggaca
gtggtggatattgacccgcctacgaggtccaacgaccccaagtcacagaaccatcctggg
tggctgatgcgtggtctcaagccctggacccagtatgccatctttgtcaagaccctggtc
accttttctgatgaacgccgtacatatggagccaagagtgacatcatctatgtccagaca
gacgccacgaatccttccgtccccttggatcccatctcagtttctaattcctcgtcccag
attattctgaagtggaagcctccctccgaccccaacggcaatatcacacactacttggtg
ttctgggagaggcaggcagaagacagtgagctgtatgaactggattattgcctcaaaggg
ttgaagctgccctcccgaacctggtctccaccgttcgagtcggaggggtcccagaagcac
aaccagagtgagtatgaggagtctgctggcgaatgctgctcctgcccgaagaccgactct
cagatcctcaaggagctggaggagtcctcgttcaggaagacgtttgaagattacctgcac
aacgtggttttcatccccagaaaatcatcttcaggccctgttgccgaggacgctaggcct
tcgaggaaacgcagagcccttggtgacgtggggaatgtgacagcagccgtgcccactgtt
ctggggttccccaatagctcctccaccagcacacccatgagctcagaggaacacagaccc
tttgagaaagtggtgaacaaggagtcgctggtcatctccggcctgcgtcactttactggc
tatcgcatcgagcttcaggcttgcaaccaagattcccctgaggagaggtgtagcgtggct
gcctatgtcagcgccaggaccatgcctgaagccaaggcagatgatattgtcggccccgtg
acccatgaaatctttgagaacaacgtcgttcacttgatgtggcaggagcccaaggaaccc
aacggtctgattgtgctgtatgaagtgagttaccgacgatacggcgaggaggagctgcac
ctctgcgtctcccgccggcattatgctctggagcgcggctgccggctgcgtgggctgctg
ccagggaattacagcgtgcgagttcgggccacctccctggcaggcaatgggtcttggacg
gaagccacctacttctacgtgacagactatttagacgtgccatcaaatattgcaaaaatc
atcatcggtcccctcatctttgtctttctcttcagtgttgtgattggaagtatttgtcta
ttcctgagaaagaggcagccagatgggccactgggaccattgtatgcttcttcaaaccca
gagtacctcagtgccagcgatgtgttcccatgctctgtgtatgtgccggacgagtgggag
gtgcctcgagagaagatcacgctcctgcgagaactggggcaaggctccttcggcatggtg
tacgagggcaacgccagggacattgtcaagggtgaggcagagacccgcgtggcagtgaag
acagtcaacgagtcggccagcctgcgagagcggatcgagtttctcaacgaggcttcagtc
atgaagggcttcacctgccaccatgtggtccgcctcctgggggtggtgtccaaaggccag
ccaacgctggtggtgatggagttgatggctcacggagacctgaagagttacctccgttcc
ctgcggcctgaggctgagaataaccccggccgccctccccctaccctgcaagagatgatt
cagatggcggcagagatcgccgatgggatggcgtacctgaacgctaagaagttcgtgcac
cgcgatcttgcagcccggaactgcatggttgcccacgactttaccgtcaaaattggagac
ttcggaatgacaagagacatctatgaaacggattactaccggaaagggggcaaaggtctg
ctccctgtgcggtggatggcacctgaatccctcaaggacggagtcttcaccacctcttca
gacatgtggtcttttggtgtggtcctttgggaaattaccagcttggcagaacagccttac
caaggtctatcaaatgagcaggtgctgaaatttgtcatggatggagggtacctggatcaa
cctgacaattgtccagagagagtcaccgacctgatgcggatgtgctggcagttcaacccc
aagatgcgtccgaccttcctggagattgtggacctactcaaggatgacctgcaccccagc
tttcccgaagtgtccttcttccacagcgaggagaacaaggcgcccgagagcgaggagctg
gaaatggagtttgaggacatggagagcgtgcccctggaccggtcctcgcacgcgcagaga
gaggaggccgggggccgggacggagggtcggcgctggggctaaagcgaatctatgacgag
cacatcccctacgcccacatgaacgggggcaagaaaaatggacggattctgactttgccc
cggtcaaatccttcctaa

DBGET integrated database retrieval system