KEGG   Pantholops hodgsonii (chiru): 102344736Help
Entry
102344736         CDS       T02909                                 

Gene name
CAMKK1
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:phd00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    102344736 (CAMKK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phd01001]
    102344736 (CAMKK1)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     102344736 (CAMKK1)
Protein kinases [BR:phd01001]
 Serine/threonine kinases: Other
  CAMKK family
   102344736 (CAMKK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 102344736
NCBI-ProteinID: XP_005975776
Position
Un
AA seq 505 aa AA seqDB search
MEGGPAVCCQDPRAELVERVAAIDVTHLEETDGSPEPPRNCVDPPSRTRAASVIPSGPSR
HPAVRPSLSTRKFSLQERPAGSCLQAQAGPYATGPASHISPRAWRRPTIESHRVAISDAE
DCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
AAQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCEKPFPEEQARLYLKDIILGLEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDARLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILA
LHRKIKNEAVVFPEEPKVSEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSE
EEHCSMVEVTEEEVQNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGSL
LSKDGFGEGGKSPELPGVQEDEAAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaggggggcccggcggtctgctgccaggaccctcgggctgagttggtggagcgagtg
gcagccattgatgtgacccacttggaggagacggatggcagcccggagcctcccaggaac
tgtgtggaccctccgtcacggaccagagcagcctccgtgatccccagcggtccttcaaga
caccctgcagtccggcccagcctctcgacaaggaagttctccctgcaggaacggccagcg
gggagctgcctgcaggcccaggctgggccttacgccacagggcctgccagtcacatctcc
ccgcgggcctggcgcaggcccaccattgagtcccaccgtgtggccatctcagacgcagag
gactgcgtacagctgaaccagtacaagctgcagagtgagattggcaagggtgcctacggc
gtggtgaggctggcctacaacgaaagtgaagacaggcactatgccatgaaagttctttcc
aagaagaagttactgaagcaatatggcttcccacgtcggcctccccccagagggtcccag
gctgcccaaggaggcccagccaagcagctgctgcccttggagcgggtgtaccaggagatt
gccattctgaagaagctggaccacgtgaatgtggtcaagctgatcgaggtcttggatgac
ccagctgaggacaatctctatttggtgtttgacctcctgagaaaggggccagtcatggaa
gtaccctgcgagaagcccttccccgaggagcaagctcgcctctacctgaaggacatcatc
ctgggccttgagtacttgcactaccagaagatcatccacagggacatcaagccatccaac
ctgctgctgggggacgacgggcacgtgaagattgctgacttcggcgtcagcaaccagttc
gaggggaacgacgctcggctgtccagcacagctgggaccccagcgttcatggcccccgag
gccatttctgactccggccagagcttcagtggaaaggccttggacgtgtgggccacaggg
gtcacgctgtactgctttgtctatgggaagtgcccgttcatcgacgattacatcctggcc
ctgcaccgcaagatcaagaacgaggccgtcgtgttccctgaggagccaaaggtcagcgaa
gagctcaaggacttaatcctgaagatgctagacaagaaccctgaaacgagaattggggtg
ccagacatcaagttgcacccctgggtgaccaagaacggggaggagccccttccctcggag
gaggagcactgcagcatggtggaggtgacagaggaggaggtgcagaactcggtcaggctc
atacccagctggaccacagtgatcctggttaagtccatgctgagaaagcgttcctttggc
aacccattcgagccccaggcacggagggaagagcgatccatgtctgccccaggaagctta
ctgtcgaaagacgggtttggcgaaggaggcaaaagcccagagctgcccggcgtccaagaa
gacgaggctgcgtcctga

DBGET integrated database retrieval system