KEGG   Pedobacter heparinus: Phep_0017Help
Entry
Phep_0017         CDS       T00978                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
phe  Pedobacter heparinus
Brite
KEGG Orthology (KO) [BR:phe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Phep_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACU02243
UniProt: C6XXI9
Position
complement(20855..21241)
Genome map
AA seq 128 aa AA seqDB search
MVTAITLGVKISVETTYQEEHSNPANAHFMFAYRITIENLTDYAVQLKRRQWFIFDSNGT
QREVEGEGVVGEQPVIEPGASHSYVSGCNLNTDMGTMSGNYLMYRIADDRDFIVDIPEFE
LIVPYRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttacagctattacattaggcgttaagatttcagttgaaacaacttaccaggaagaa
cattctaatccggctaacgcacattttatgtttgcttaccgcattacaattgaaaacctg
accgactatgccgtacagcttaaaagaaggcagtggtttatatttgactctaatggtaca
caaagagaagtagaaggtgagggcgttgttggtgaacaacccgtaatagaacctggggcc
agccattcttatgtatcaggctgtaatttaaacacggatatgggtaccatgagtggtaat
tacctgatgtaccggattgccgatgacagggactttattgtagatatccccgaatttgaa
ttgattgtaccttaccgcttaaattaa

DBGET integrated database retrieval system