KEGG   Pedobacter heparinus: Phep_0172Help
Entry
Phep_0172         CDS       T00978                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
phe  Pedobacter heparinus
Pathway
phe00010  Glycolysis / Gluconeogenesis
phe00020  Citrate cycle (TCA cycle)
phe00620  Pyruvate metabolism
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01120  Microbial metabolism in diverse environments
phe01130  Biosynthesis of antibiotics
phe01200  Carbon metabolism
Module
phe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Phep_0172
   00020 Citrate cycle (TCA cycle)
    Phep_0172
   00620 Pyruvate metabolism
    Phep_0172
Enzymes [BR:phe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Phep_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H PYNP_C Biotin_lipoyl_2 DUF2118
Motif
Other DBs
NCBI-ProteinID: ACU02398
UniProt: C6XYD1
Position
200882..202537
Genome map
AA seq 551 aa AA seqDB search
MAEIVRMPKMSDTMTEGVMAKWHKKVGDKVKSGDVMAEVETDKATMDLESYWDGTILYIG
VEEGKAVPVDAIIAVVGKEGEDYKAALAAEEGAAPVPAKEEKAAEPSSEKPAEDGSGTTA
GLSEAELTAKGVTVIRMPLLSDTMTEGVIAEWHKKVGDKVKDDDILADVETDKATMEVMG
YATGTLLHIGVEKGQAAKVNGIIAIVGPEGTDISGILSQGDAPAKPAADAKSDAPVAEKA
VAEVKEETPVASGSGERLKASPLAKRIAKDKGIDLAQVAGSADGGRIIKKDIENFKPAAA
PANTASSSAPAAEKAAPVIPQYVGEEKYTEKPVSQMRKVIAKRLAESLFTAPHFYLNISI
DMDNAISARTAINAVAPVKISFNDIVIKAVAVALKQHPAVNSSWGGDKIRFNEHTNIGVA
MAVEDGLLVPVVRFADGKSLSHISAEVKAYGQKAKAKKLQPSDWEGSTFTVSNLGMFGID
EFTSIINSPDGAILSVGAIQQVPVVKNGAVVPGNIMKLSLGCDHRVVDGATGAAFLQTLK
GLLEEPIRLLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatagttagaatgcccaaaatgagtgataccatgaccgaaggggtgatggct
aagtggcataaaaaagttggcgataaagtaaaaagcggtgatgtaatggccgaagtggaa
accgataaggctactatggatttagaatcatactgggatggtaccattttatacattggt
gtagaagagggaaaagctgttccggttgatgccattattgcagtagtaggtaaggaaggc
gaagattataaagctgcactggcagcagaagaaggtgctgctccagtaccagccaaagag
gagaaagctgctgagccatcatcagaaaaacctgctgaagatggttctggtacaacagct
gggttatcggaagctgagcttactgcaaaaggggttaccgttatccgcatgcctttatta
agtgataccatgactgaaggcgtgattgctgaatggcataaaaaagtaggtgataaagta
aaagacgatgatatccttgctgatgtagagaccgataaggccactatggaagtgatgggt
tatgctaccggaactttattgcatattggtgtagaaaaaggacaggctgccaaagtaaat
ggtattattgccattgttggcccggaaggaactgacattagtggaatcctgagccagggc
gatgcgcctgccaaacctgccgcagatgcaaaatctgatgcgcctgttgcagaaaaagct
gttgctgaagtaaaagaagagactcctgtagcctctggtagtggagaacgtttaaaagca
tcgccgctggctaaacggattgccaaagataaaggtattgatctggcccaggttgcaggt
agtgctgatggtggcaggatcattaaaaaagatatagaaaactttaaacctgcggcagcc
ccggcaaatacagcatcttcatcagctccggctgcagagaaagccgcaccggttattcct
caatatgtaggtgaagaaaaatatacagagaaaccagtctcgcaaatgcgtaaggtgatt
gccaaacgtttggcagaaagcctgtttactgcccctcatttttacctgaacatcagtatt
gatatggacaatgccatatcagcccgtactgcaatcaatgcggtggctcccgtgaagatt
tctttcaatgacattgtcattaaagcagttgccgttgcattgaaacaacatcctgccgtt
aactcttcatggggcggagataagatccgtttcaatgagcatacgaacattggtgtggcc
atggctgtagaagatggtttactggttcctgtagttcgttttgctgatggcaaatcgttg
tctcatatctctgctgaggttaaggcatatgggcagaaagcaaaagctaaaaaactacaa
ccgtcagactgggaaggttctacctttaccgtttctaacctgggtatgtttggtattgat
gaatttacatcaatcattaactctccggatggtgcgatcctatctgtaggtgctatacag
caggtacctgtggttaaaaacggagcggttgttcctggtaacatcatgaagctaagttta
ggctgcgatcaccgtgtggttgatggggctacaggtgccgcgttcctgcaaacgcttaaa
ggcttgctggaagagccaataagattattggtttaa

DBGET integrated database retrieval system