KEGG   Pedobacter heparinus: Phep_0434Help
Entry
Phep_0434         CDS       T00978                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
phe  Pedobacter heparinus
Pathway
phe00511  Other glycan degradation
phe00520  Amino sugar and nucleotide sugar metabolism
phe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Phep_0434
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Phep_0434
Enzymes [BR:phe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Phep_0434
Chaperones and folding catalysts [BR:phe03110]
 Intramolecular chaperones
  Others
   Phep_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b CHB_HEX_C_1 Fn3_assoc Glyco_hydro_67N CHB_HEX_C Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: ACU02658
UniProt: C6XZW3
Position
508123..509979
Genome map
AA seq 618 aa AA seqDB search
MMIKRMFFMLCLIWMSAANPAFSQRVSIIPQPLSVAELPGNFKINSLTKITYDAGNSDLK
SVGLQFSDQLKKLCGYALKVLPATAATGSNVIVLTTKNAVDSLGDEGYTLIANAKGVTIS
GKKAHGVFYGAQTLYQLLPVKGKNNTLVAAPLIPAVKIADKPRFGWRGMMLDVGRYFYSV
EFVKKYIDNLALHKLNVFHWHLTEDHGWRIEIKKYPRLTSIGAWRNGTQFANNQIDNNPH
GGFYTQDQIRDIVAYAAKRYVTVVPEIEMPGHATAALVAYPNVSCTGGPFKMLTGWGIQK
EVFCAGKEETFNFLEDILSEVVALFPGKFIHIGGDECPKDRWKVCPNCQARMKKENLKDE
HELQSYFIRRIEKFLTTKNKSIIGWDEILEGGLAPNAAVMSWRGTEGGIAAAKQLHDVVM
TPYDFLYLDYYQGEPYLEPKAIGGNLQLEKVYNYEPVPAVLTAEQAKYIKGVQGNVWAEF
IHSPEKVEYMAFPRAAAMAELAWTIPARKSWTDFSRRIEKQYQRYDDLGINYARSAYNVW
HTVTVDSVANKARVSFKTNSYQPQVRYSLDGSEPTVNSLAYSKPFEVKLPVTIKAATFKD
GRRMGAISSRSIFVDQNK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcaaaagaatgttttttatgctgtgcctgatctggatgagtgcagcgaacccg
gcatttagccagcgggtatccattattccgcaacctttaagtgttgctgaacttccagga
aactttaaaatcaattcccttaccaaaattacttatgatgcgggcaattccgacctgaag
tcggtaggccttcaattttccgatcagctaaaaaagctgtgcggttacgccttaaaagta
cttccggctacagctgctacagggagcaatgtaattgtgctgaccacaaaaaacgccgta
gacagtctgggtgatgaaggttataccttaattgccaatgcaaagggcgttaccatcagc
ggtaaaaaagcacatggcgtattttatggggcccaaaccctgtatcagcttttgccggta
aaaggaaaaaataatacccttgttgctgcaccgctaattccggcggtaaaaattgccgat
aagccacgctttggctggaggggaatgatgcttgacgtgggccgttatttttactccgtg
gagtttgttaaaaaatacatcgacaacctcgctttacataaactgaatgtgtttcactgg
catttaaccgaagaccatggctggcgcatcgagattaaaaaataccccagactcacttca
ataggcgcatggcgcaatggaacgcagtttgccaacaaccagatcgataacaacccgcat
ggcgggttttacacgcaagaccagatcagggatatcgttgcctatgcggcaaaacgttat
gtaacggtggttcccgaaattgaaatgccgggccatgctacggcagccctggtggcctat
cctaacgtttcctgcacaggcgggccttttaaaatgctgacaggatggggtatccagaaa
gaagttttctgtgccggaaaagaagagacctttaatttcctggaagatatcctttcggaa
gttgtagcactctttcccggtaaattcatccacatcggcggagatgaatgtcctaaagac
cgttggaaagtttgcccaaactgccaggccaggatgaaaaaagaaaacctgaaagacgag
catgaactgcaaagctatttcatcaggcgcatagaaaaattcctgaccaccaaaaataaa
agcattattggctgggatgaaattctggaaggcggcctggcacctaatgctgctgtcatg
tcctggaggggcaccgaaggtggtattgctgcagccaaacaattgcatgatgtagtgatg
accccctacgattttctttacctggattattatcagggcgaaccctatctggaaccaaag
gcaataggtggtaatctgcagctggaaaaggtatacaactatgagcctgtaccagcagtg
cttactgccgagcaggcaaaatatattaaaggcgtacagggcaatgtatgggcagaattt
atccattcgcccgaaaaagtagaatacatggcctttccacgcgctgctgcgatggccgaa
ctggcctggaccataccagcccggaaaagctggactgattttagccgcaggatagaaaag
caataccagcgctacgatgacctgggcatcaattacgccagaagcgcctataatgtatgg
cataccgtaacggtcgacagtgtggccaataaagcaagggtatcctttaaaaccaatagt
tatcagccgcaggtgcgctatagcctggatggttcagaaccaacagtaaattcgctggcc
tacagcaaacccttcgaagttaaattaccggtcaccattaaagcagctacttttaaagat
ggccgccgcatgggggcaatcagttcaaggtcaatatttgtagatcagaataaataa

DBGET integrated database retrieval system