KEGG   Pedobacter heparinus: Phep_1173Help
Entry
Phep_1173         CDS       T00978                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
phe  Pedobacter heparinus
Pathway
phe00240  Pyrimidine metabolism
phe00250  Alanine, aspartate and glutamate metabolism
phe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Phep_1173
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Phep_1173
Enzymes [BR:phe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Phep_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Pribosyltran DUF4431
Motif
Other DBs
NCBI-ProteinID: ACU03391
UniProt: C6Y3W2
Position
complement(1389914..1390846)
Genome map
AA seq 310 aa AA seqDB search
MAVEKLSTRHLLGIKDINRNDIELIFETADNFKDVINRPIKRVPSLRDITIANIFFENST
RTKLSFELAEKRLSADVVNFAASSSSVSKGETLIDTVNNILAMKVDMVVMRHPYAGAGQF
LSRHIKAQIVNAGDGAHEHPTQALLDAFSIRQKLGDVAGKKVVIVGDILHSRVAISNILC
LQKLGAEVMVCGPTTLIPKHIESLGVKVEHNLIKALNWCDVANMLRIQLERQDIKYFPSL
REYAMMYGLNKQILDNLDKEIVIMHPGPINRGVEITSDVADSKQSIILEQVENGVAVRMA
VLYLLAAQND
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagaaaaattatcaacccgacatctcttaggcatcaaagatattaaccggaat
gatatcgaactgatcttcgagactgcagataattttaaagatgtgattaaccggcccata
aaaagggtgccctcattaagggacatcaccattgccaatatattttttgagaactccaca
cggaccaaactttcttttgaactggcagaaaaaagactttcggccgatgtggtcaacttt
gctgcatcctcatcttctgtaagtaaaggtgaaacgctgatagatactgtaaacaatatc
ctggctatgaaagtagacatggtagtgatgagacacccttatgcgggtgcaggtcagttt
ttgagcagacacattaaagcccagattgtaaatgccggcgacggtgcccatgaacaccca
acacaggctttactggatgctttttcaatccggcagaagcttggcgatgtggccggaaaa
aaagtagtgatcgttggcgatatcctgcactccagggtagccatttccaatattctttgt
ttacaaaaattaggtgccgaagtaatggtctgcggccccactaccctgatcccaaagcac
attgaaagtttaggtgtaaaagttgaacacaacctgatcaaagccctgaactggtgcgat
gtagccaatatgctgcgcatacaactggaaagacaggacatcaaatacttcccctcttta
agagaatatgccatgatgtacggactgaacaaacagattcttgacaatctggataaagaa
attgtgatcatgcaccccggaccgataaaccgtggcgtagagatcaccagtgacgtagcc
gacagcaaacaatccatcatcctggagcaggttgaaaacggggttgccgtacgtatggct
gtcctgtacctgctggccgcccaaaacgactaa

DBGET integrated database retrieval system