KEGG   Pedobacter heparinus: Phep_1872Help
Entry
Phep_1872         CDS       T00978                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
phe  Pedobacter heparinus
Pathway
phe00020  Citrate cycle (TCA cycle)
phe00310  Lysine degradation
phe01100  Metabolic pathways
phe01110  Biosynthesis of secondary metabolites
phe01120  Microbial metabolism in diverse environments
phe01130  Biosynthesis of antibiotics
phe01200  Carbon metabolism
Module
phe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:phe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Phep_1872
  Amino acid metabolism
   00310 Lysine degradation
    Phep_1872
Enzymes [BR:phe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Phep_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACU04080
UniProt: C6XW01
Position
2163736..2165058
Genome map
AA seq 440 aa AA seqDB search
MAQYELLLPKMGESVAEATIIKWVKQPGELIEMDDTVLEIATDKVDSEVPSPIAGRLVKQ
LFKEDDIVQVGAVIAIIETDADAPVVAEQAVETPAAVSVPEAEPVTANIPGMEQLPADFV
SDRFYSPLVKNIALQEGITVEELDTISGTGAEGRLTKDDLLNYIQNGKKTGDVSREEEVK
PVAQQSAVAQPLKVQPTQAAASISGGDEIIEMDRMRKLIAEHMVMSKQTSPHVTSFVEAD
VTNMVLWREKVKRDFEKRENEKITFTPIFVEAVSRAIKDFPMINVSVNGNQIIKKKDINI
GMAAALPSGNLIVPVIKNADELNLLGLTKAVNDLASRARASKLKPDETQNGTFTLTNVGS
FGNVMGTPIINQPQVAILAVGAIKKKPAVLETEAGDVIAIRHIMFLSLSYDHRVVDGALG
GSFVRRVADYLEKWDLNREI
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatacgaattattgttacctaaaatgggggagagcgttgcggaagcaaccata
attaaatgggttaaacaaccgggtgaactgattgagatggatgacactgttttggagatt
gccacggataaagtagattctgaagtcccatcgccaatagcgggtagattagtaaagcaa
ttatttaaagaagacgatattgtacaggtaggtgccgtaattgcgattatagaaacggat
gccgatgccccggtagttgctgagcaggcagttgaaactcctgcagcagtaagcgtacct
gaggcggagccagttacagcaaacataccggggatggaacagcttcctgctgattttgtc
tcagaccgtttttattcgcccctggtaaaaaatattgcattacaggagggaataactgtt
gaagaattggatacaattagcggaaccggtgctgaagggcgtttaactaaagatgattta
ttgaactatattcaaaacgggaaaaaaactggcgatgtaagcagagaggaagaagtgaag
cccgtagcccagcagtctgcagtcgcacaacccctaaaagttcagccaactcaggcagcg
gcaagtataagtggtggtgatgagatcattgagatggacaggatgcgtaagttaattgcc
gaacacatggtaatgagcaaacagacctctccgcatgtaacctcttttgtagaagcagat
gtaaccaatatggtactatggcgtgaaaaggtaaaaagggattttgagaagcgtgaaaac
gagaagatcacctttacgcccatatttgtggaagcggtaagcagggcgatcaaagatttt
ccgatgatcaatgtatcggtaaacggaaatcagatcattaagaaaaaagatatcaatatc
ggtatggcagctgcattaccaagtggtaacctgattgtgccggtaataaaaaatgcggat
gagctgaacctgctgggtttaacaaaagcggttaacgacctggccagccgtgcccgggcc
tcgaaattaaagcctgatgaaacgcaaaacggcactttcaccttaaccaatgtgggttct
tttggtaatgtaatgggcacaccgatcattaatcagccgcaggtagctatattggctgtg
ggtgccattaaaaagaaaccagcggtgttggaaacggaagctggtgatgtgattgcgatc
aggcatatcatgttcctttctttatcttatgaccacagggttgttgacggggcccttggg
ggttcattcgtacgccgggtggccgattacctggaaaaatgggaccttaacagagaaata
tag

DBGET integrated database retrieval system